PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G079900.1.p
Common NameGLYMA_17G079900, LOC102670246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 390aa    MW: 42546.8 Da    PI: 8.9434
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G079900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP83.94.1e-2657132379
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                          g+kdrhsk++T +g+RdRR+Rls+++a++++dLq++LG+ ++sk ++WLl+  k  i++l+ +++++  ++ ++++ 
  Glyma.17G079900.1.p  57 GGKDRHSKVCTIRGLRDRRIRLSVPTAIELYDLQEKLGLNQPSKVVDWLLETTKSDIDKLPPLQFPHC-FAHHHQQT 132
                          78*************************************************************55544.22222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.9E-2258170IPR005333Transcription factor, TCP
PROSITE profilePS5136927.69858116IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MMIESSSKVH GANNQQEGDD NNIKIEKLSK APSTSSSSRS WSAFRNPRIV RVSRSLGGKD  60
RHSKVCTIRG LRDRRIRLSV PTAIELYDLQ EKLGLNQPSK VVDWLLETTK SDIDKLPPLQ  120
FPHCFAHHHQ QTLLPGTSQF SLGGFYDAAA NGGNENHLMA TKSTRYWDID SHSLNNGKDL  180
VESVSNSLKG KSWIKTNEQE NHQDGGIGGS SSTHNNREEY SSAHYKLFPI GTTTNNSYLP  240
GLLNNGMTHN SSNHHSEPSS LSLSHFGSHG LFPSSHNAHP SSCSGVPFSS CNFSAASSGP  300
QLLFCPPTSA TPASAFYSVE SDPRQSNNNV QIFSSSSQVM MPHPLIQSLH STNSTLNRRI  360
PTSFSSKLLD SDNNNDRSQP NKGSSTTRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1763117155Putative transcription factor PCF6
5zkt_B1e-1763117155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G079900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600589.10.0transcription factor TCP17
RefseqXP_006600590.10.0transcription factor TCP17
RefseqXP_006600591.10.0transcription factor TCP17
RefseqXP_028209856.10.0transcription factor TCP17-like
RefseqXP_028209858.10.0transcription factor TCP17-like
TrEMBLA0A445G3S20.0A0A445G3S2_GLYSO; Transcription factor TCP5
TrEMBLK7MKI80.0K7MKI8_SOYBN; Uncharacterized protein
STRINGGLYMA17G08761.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.11e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5