PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G076000.1.p
Common NameGLYMA_17G076000, LOC100803040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 682aa    MW: 75164.2 Da    PI: 5.1623
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G076000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.22.8e-26209262155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+W  eLH++F+ a+++L G++kA Pk+il+lm+v+gLt+e+++SHLQkYRl
  Glyma.17G076000.1.p 209 KPRLVWDAELHRKFLAAINHL-GIDKAFPKRILDLMNVEGLTRENIASHLQKYRL 262
                          79*******************.********************************8 PP

2Response_reg81.23.5e-27131211109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+++ +++l+++l+k +y +v+++ ++ +al++l++++  +Dl++ D++mp+mdG++ll+  +  e++lp+i+++++g++e + +
  Glyma.17G076000.1.p  13 VLAVDDDETCLSVLENLLRKCQY-NVTTTNQAIKALDMLRKNRnkFDLVISDVNMPDMDGFKLLELVEL-EMDLPVIMLSGYGDKERVMR 100
                          799********************.***************998889*******************87655.669***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l+Kp+ +eel +
  Glyma.17G076000.1.p 101 GVIHGACDYLTKPVRIEELQN 121
                          ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.3E-1481681IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.0E-4210134No hitNo description
SuperFamilySSF521726.69E-3610134IPR011006CheY-like superfamily
SMARTSM004481.3E-3211123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.90212127IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.9E-2413121IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.58E-2814126No hitNo description
PROSITE profilePS5129411.39206265IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-27206266IPR009057Homeodomain-like
SuperFamilySSF466892.69E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-24209262IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MGVEDRFPVG MRVLAVDDDE TCLSVLENLL RKCQYNVTTT NQAIKALDML RKNRNKFDLV  60
ISDVNMPDMD GFKLLELVEL EMDLPVIMLS GYGDKERVMR GVIHGACDYL TKPVRIEELQ  120
NIWQHVVRRR IDSKDKNKTA SEGKACSMAG KLANEEKACY MAGECSQAMA SKSNADQNIK  180
LGQKRKEQSE DEEEEEYDQE NEEPSNQKKP RLVWDAELHR KFLAAINHLG IDKAFPKRIL  240
DLMNVEGLTR ENIASHLQKY RLGLKKSTQQ PSMVATLGNS DPYQQMDSIE GFRTLSGSGG  300
MISTTLPSYA SGGLFCRLNS PSGLRGINSS LLVQPVHSQN IDSRSIKTLG NMQLSMFSAN  360
QTSSLLQGIP TSIDGNQFQQ NNCSIGIRKL SPLDDLSSGF KVSSGFSNSR ATVRNPNNSL  420
HGLSNNHLLL QGNSPPTHNS GAFGNHSSLG AASVKTQSFD PGICELGYNR CNKSWQGTTQ  480
ISKFPANTSA VSNNDQLAQN NLNFSSSTFC SGNSPVDFSS TSVVAPPLED ARGKLRCQEG  540
LLENILLTSC YTQHQSWEAD NRGCNKEMSQ TFNTIKSVSP NGDTSSLGHS LDQNNTVSSK  600
RIDVSLVNPS VTQSSEDEKF YSMESIDGCI LQSMESQEDL MQNTFESLDD IMSEITKQEQ  660
NAIMLMDGEM EFDAYHVGSC I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-25207266362ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G076000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600557.10.0two-component response regulator ARR12 isoform X1
RefseqXP_028208240.10.0two-component response regulator ARR12-like isoform X1
TrEMBLA0A445G3J10.0A0A445G3J1_GLYSO; Two-component response regulator
TrEMBLK7MKF20.0K7MKF2_SOYBN; Two-component response regulator
STRINGGLYMA17G08380.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-107response regulator 12