PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G056300.1.p
Common NameGLYMA_17G056300, LOC100813377
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 210aa    MW: 23720.2 Da    PI: 9.604
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G056300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-1992146256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++k+q   Le+ F+++++++  +++ LA++l+L++rqV vWFqNrRa+ k
  Glyma.17G056300.1.p  92 RKKLRLSKDQSSMLENSFKQHSTLNPVQKQALADQLNLKTRQVEVWFQNRRARTK 146
                          677889***********************************************98 PP

2HD-ZIP_I/II1093.3e-3592180189
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                          +kk+rlsk+q+++LE+sF+++++L+p +K++la +L+l++rqv+vWFqnrRARtk+kq+E++ e Lk+++++l++en+rL+ke +eLr+
  Glyma.17G056300.1.p  92 RKKLRLSKDQSSMLENSFKQHSTLNPVQKQALADQLNLKTRQVEVWFQNRRARTKLKQTEVNRELLKKHCQNLSDENKRLKKELQELRA 180
                          69*************************************************************************************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1879149IPR009057Homeodomain-like
PROSITE profilePS5007116.64988148IPR001356Homeobox domain
SMARTSM003892.1E-1690152IPR001356Homeobox domain
CDDcd000864.75E-1492149No hitNo description
PfamPF000463.3E-1692146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.7E-1892146IPR009057Homeodomain-like
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
SMARTSM003407.7E-15148192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MEDNNEECIA GLCLGLGLGL GSGHVPKKNK QKENKAVVCL DLAFELCPKG EKAVNNVNHH  60
HDKVERISLE RIHDYPNEKS TDSDNSNNNG CRKKLRLSKD QSSMLENSFK QHSTLNPVQK  120
QALADQLNLK TRQVEVWFQN RRARTKLKQT EVNRELLKKH CQNLSDENKR LKKELQELRA  180
VKVGPSPPCI QLSKTATLTM CSLCQKLVN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.297681e-96root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G056300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311690.0KT031169.1 Glycine max clone HN_CCL_118 homeodomain/HOMEOBOX transcription factor (Glyma13g00310.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550639.11e-151homeobox-leucine zipper protein HAT22
TrEMBLI1MSI41e-150I1MSI4_SOYBN; Uncharacterized protein
STRINGGLYMA17G06380.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-48homeobox from Arabidopsis thaliana