PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G039600.1.p
Common NameGLYMA_17G039600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1006aa    MW: 111363 Da    PI: 7.7138
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G039600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.7e-40160237178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqv++C+adls+ak+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Glyma.17G039600.1.p 160 VCQVQDCRADLSNAKDYHRRHKVCDIHSKATMALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 237
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-31155222IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.898158235IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-37159240IPR004333Transcription factor, SBP-box
PfamPF031108.2E-29161234IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.1E-6277301IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.34E-6805924IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-6811922IPR020683Ankyrin repeat-containing domain
CDDcd002041.02E-7811921No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1006 aa     Download sequence    Send to blast
MEAEFGAKNQ YLYGPVVSGM KKAVVGNGKR SLEWDLNDWR WDGDLFTAQP LNSVPSDCRG  60
RQFSPPHPEI PAKNANPSTT NLSYSVFISG EGKRELEKRR RGVIGEGEGE GLNYEAGSLS  120
LNLAGQGYPL MVEEEEKSGK KTKVIGTTTA STTTASNRAV CQVQDCRADL SNAKDYHRRH  180
KVCDIHSKAT MALVGNVMQR FCQQCSRFHV LQEFDEGKRS CRRRLAGHNR RRRKTHPDVS  240
VVNEGSLNDQ RGSNYLLMSL LRILTNLHSN GSDHTRNQDI LSHLLKNLAS LAGPNNGGRL  300
APLLEESKDL VNAGTPGAAQ DKPNLNSNAP EASRPSSFIK TDNVIITQDP TMPVAQYETP  360
ADGRTQKCIA SGDGGVGNSK PPSRPLFSNV CQPRDSLPSQ LTTAETKVGR GNLNNIDLNN  420
GYNDIQNTVE NHKKPYPPVA SVMGSIDRAS WLQRDSLKSS PPQTSRNSDS TSIQSPSSSS  480
GEAQSRTDRI VFKLFGKDPS DFPLLIRSQI LNWLSHSPTE MESYIRPGCI ILTIYLRLEK  540
SAWEELYCNL GSSLRKLLAE SNDSFWRTGW VYARVQHSVA FLYNGQVVLD VPLHLKSPQH  600
CRISCIKPLA VPASASAQFI VKGFNLFQSS TRLLCALEGK YLVHASCHGL IGGADAPIQH  660
LSFSCHIPNV TGRGFIEVED HGLSSCSFPF IVAEQEVCSE ICKLENVIEA AETTDDIQIK  720
KQQMEEMTRA LDFLQEMGWL LHRSHVKVKL GPMAPFRDLF QFNRFAWLVD FSMDHGWCAV  780
MNKLLDIIFE GGVDAGEHAS IELALLNMGL LHTAVKRNCR PMVELLLRFV PVKTSDGADS  840
EVKQVDEASD RFLFRPDTVG PAGLTPLHVA ASMSGLEDVL DALTDDPRML GIEAWKSSRD  900
STGLTPNDYA CLRGYYSYIQ LVQKKTNKKG ERQHVVDITG IVVDSYTTQK QSNGHRTSMV  960
YWPVMLTMVT IAAVCVCVAL LFKSSPRVYY VFQPFNWESL EYGAM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29152234284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.274390.0flower| meristem| pod| root| seed coat| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.17G039600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028241527.10.0squamosa promoter-binding-like protein 1
RefseqXP_028241528.10.0squamosa promoter-binding-like protein 1
TrEMBLA0A0R0FJD60.0A0A0R0FJD6_SOYBN; Uncharacterized protein
STRINGGLYMA17G04400.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Representative plantOGRP25951432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1