PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G007600.1.p
Common NameGLYMA_17G007600, LOC100776109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 546aa    MW: 60855.4 Da    PI: 6.5015
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G007600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS409.14.3e-1251775454374
                 GRAS   4 lLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +L  cA+avs++d   a+  + + l +l+s +gdp+qRl ay++e+L+arl +s++ +yk+l++++ +   s+e +++++++++++P+ k
  Glyma.17G007600.1.p 177 ALKVCAQAVSDDDVPTARGWIDNvLGKLVSVSGDPIQRLGAYLLEGLRARLESSGNLIYKSLKCEQPT---SKELMSYMHILYQICPYWK 263
                          6888**************9997527888***************************************9...99999************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          f+++ aN  I e +++e+r+HiiDf+i qG+QW  L+qaLa Rp+gppslR+Tgv++++s+  +   l  +gerL++fA+++gvpfef+ 
  Glyma.17G007600.1.p 264 FAYISANAVIQETMANESRIHIIDFQIAQGTQWHLLIQALAHRPGGPPSLRVTGVDDSQSThaRGGGLWIVGERLSDFARSCGVPFEFHS 353
                          *********************************************************9988888999*********************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           +a +  ++   +++++ gEalaVn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy+a+f+s
  Glyma.17G007600.1.p 354 -AAISGCEVVRGNIEIRAGEALAVNFPYVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTFVEQESNTNTSPFFQRFVETLDYYTAMFES 442
                          .56666777799****************************************************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          +++  pr++++ri+ E+++++r+ vn++aceg er+erhe ++kWr+rl++aGFk+ +ls++++   + ll++++++ yr+e+++g+l+l
  Glyma.17G007600.1.p 443 IDVACPRDDKKRISAEQHCVARDMVNMIACEGVERVERHELFGKWRSRLSMAGFKQCQLSSSVMVATQNLLKEFSQN-YRLEHRDGALYL 531
                          ***************************************************************************66.************ PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          gW++r + + SaWr
  Glyma.17G007600.1.p 532 GWMNRHMATSSAWR 545
                          *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.499148526IPR005202Transcription factor GRAS
PfamPF035141.5E-122177545IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MQTSQKHPSS AGAHFYHQPV QGIYQMLQSN LCQDSSSQGT SVSFETCKEQ YFTLESCPAP  60
TNDFMDCDDS PSYASVSSKR TPFSPQGSQS CYSDHHQSSD NTYGSPISGL SSVDDRHQLK  120
HKLRELEISL LAPEESDITD SCGCCVVKGG LHGSSQLAKH NWDQIAENIA QFDLKGALKV  180
CAQAVSDDDV PTARGWIDNV LGKLVSVSGD PIQRLGAYLL EGLRARLESS GNLIYKSLKC  240
EQPTSKELMS YMHILYQICP YWKFAYISAN AVIQETMANE SRIHIIDFQI AQGTQWHLLI  300
QALAHRPGGP PSLRVTGVDD SQSTHARGGG LWIVGERLSD FARSCGVPFE FHSAAISGCE  360
VVRGNIEIRA GEALAVNFPY VLHHMPDESV STENHRDRLL RLVKSLSPKV VTFVEQESNT  420
NTSPFFQRFV ETLDYYTAMF ESIDVACPRD DKKRISAEQH CVARDMVNMI ACEGVERVER  480
HELFGKWRSR LSMAGFKQCQ LSSSVMVATQ NLLKEFSQNY RLEHRDGALY LGWMNRHMAT  540
SSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-5420854536375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.430920.0vegetative bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977040.0BT097704.1 Soybean clone JCVI-FLGm-22M20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549525.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLI1MQZ70.0I1MQZ7_SOYBN; Uncharacterized protein
STRINGGLYMA17G01150.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13