PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G196700.1.p
Common NameGLYMA_16G196700, LOC100784656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 776aa    MW: 84753.3 Da    PI: 5.8833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G196700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.96.5e-2289144156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe++F+++++p++++r++L+k+lgL+ +qVk+WFqNrR+++k
  Glyma.16G196700.1.p  89 KKKYHRHTPQQIQELEAFFKECPHPDEKQRTDLSKRLGLENKQVKFWFQNRRTQMK 144
                          79999************************************************999 PP

2START176.71.4e-553015242205
                          HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          la++a++el+k+a+ +  +W kss    e +n de+ + f++  +      + +ea r +gvv + +  lve+l+d   qW+e++     
  Glyma.16G196700.1.p 301 LALSAMNELIKMAQPDTSLWIKSSdgrnEVLNHDEYARLFSPYIGskpaagYVTEATRGTGVVSASSLGLVEILMDAD-QWSEMFSsmia 389
                          6899********************9999999**********99999********************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a+t+ev+ssg      galq+m ae q+lsplvp R + f+R+++++ +g w++vdvSvd  +++++s++++ +++lpSg++i++++ng
  Glyma.16G196700.1.p 390 SAATVEVLSSGtggtrsGALQVMLAEVQLLSPLVPaRQVSFLRFCKKHAEGLWAVVDVSVDIGRNVTNSHPLMSCRRLPSGCVIQDMPNG 479
                          ****************************************************************************************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                           s++twveh  ++++++h+l+r+lv+sg+ +ga++w atl rqc 
  Glyma.16G196700.1.p 480 FSNITWVEHSQYDESVIHQLYRPLVSSGIGFGAQRWIATLLRQCD 524
                          ******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-2169146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-2374140IPR009057Homeodomain-like
PROSITE profilePS5007117.96186146IPR001356Homeobox domain
SMARTSM003892.5E-1988150IPR001356Homeobox domain
PfamPF000461.9E-1989144IPR001356Homeobox domain
CDDcd000864.52E-1893146No hitNo description
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PROSITE profilePS5084843.495291528IPR002913START domain
SuperFamilySSF559611.17E-31293525No hitNo description
CDDcd088752.34E-107295523No hitNo description
SMARTSM002342.0E-39300525IPR002913START domain
PfamPF018524.7E-47301524IPR002913START domain
SuperFamilySSF559616.04E-17543747No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MASFFTVEPP LFSSPFNISK QNPSTLNLSV QRRMEGHSEM GLMGESFDTS NLLGRMRDDE  60
YESRSGSDNF DGGSGDDQDA GDDQPHKKKK KYHRHTPQQI QELEAFFKEC PHPDEKQRTD  120
LSKRLGLENK QVKFWFQNRR TQMKTQLERH ENMILRQEND KLRAENSVMK DALANPICNN  180
CGGPAIPGQI SLEEHQTRME NARLKDELNR ICALANKFLG RPLSPLASPM ALPPSNSGLE  240
LAIGRNGLGG SSNFGMPLPM GFDVGDGALG SSPAMSTMGA RSPMGMMGNE IQLERSMLLD  300
LALSAMNELI KMAQPDTSLW IKSSDGRNEV LNHDEYARLF SPYIGSKPAA GYVTEATRGT  360
GVVSASSLGL VEILMDADQW SEMFSSMIAS AATVEVLSSG TGGTRSGALQ VMLAEVQLLS  420
PLVPARQVSF LRFCKKHAEG LWAVVDVSVD IGRNVTNSHP LMSCRRLPSG CVIQDMPNGF  480
SNITWVEHSQ YDESVIHQLY RPLVSSGIGF GAQRWIATLL RQCDCLAILR SPQGPSEDPT  540
AQAGRTNMMK LAQRMTECFC SGICASSACK WDILHIGNLA DDMRIMARKI DDPTEAPGIV  600
LSASTSVWMP VSRKRVFDFL RDENLRGEWD LLSKDGPMKE MLHIAKGQDR GNCVSILHSA  660
NSECNVLYLQ ESWSDASGSM VVYSPINMQA LQMVMSCGDS SFVPLRPSGF AILPDGTSNN  720
GDGSDGGGSC LLTVGLQMLP NGNHQSAKFT MESVDAVNNL ISFTIQKVKD ALGVA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G196700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006599621.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLK7MIK70.0K7MIK7_SOYBN; Uncharacterized protein
STRINGGLYMA16G32130.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]