PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G167600.1.p
Common NameGLYMA_16G167600, LOC100804788
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 656aa    MW: 72704.9 Da    PI: 4.9561
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G167600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.35e-2963146186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW+kqe+laL+++r++m+ ++r+++ k+plWeevs+k++e g++r++k+Ckek+en+ k++k++keg++++++++  t+++fdql+
  Glyma.16G167600.1.p  63 RWPKQETLALLKIRSDMDVAFRDASVKGPLWEEVSRKLAELGYNRNAKKCKEKFENVYKYHKRTKEGRSGKSEGK--TYRFFDQLQ 146
                          8********************************************************************975544..6******98 PP

2trihelix104.76.6e-33472557187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev+aLi++r+++e++++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  Glyma.16G167600.1.p 472 RWPKVEVQALINLRTSLETKYQESGPKGPLWEEISALMRKMGYNRNAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 557
                          8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.9E-460122IPR001005SANT/Myb domain
CDDcd122032.23E-2462127No hitNo description
PROSITE profilePS500906.95762120IPR017877Myb-like domain
PfamPF138375.7E-1962148No hitNo description
PROSITE profilePS500907.108465529IPR017877Myb-like domain
SMARTSM007170.001469531IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-4470528IPR009057Homeodomain-like
CDDcd122032.10E-28471536No hitNo description
PfamPF138377.2E-22471558No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MLGDSAVLGT GGGGSGDAVA APPPAASGGA HDGGVDGGDG GGGGSNSGDD RVEEGERSFG  60
GNRWPKQETL ALLKIRSDMD VAFRDASVKG PLWEEVSRKL AELGYNRNAK KCKEKFENVY  120
KYHKRTKEGR SGKSEGKTYR FFDQLQALEN NPAIHGKQSP TPPKPPPQTT ALSATPVSIV  180
VTTTTTTPSS IIMPLPLPPV SNNNNNTTVP STTSLPMPQS ILNITPPSTL NITIPSFPPS  240
NPTTYFPTQT PNPTSNNNNN PPSTITPPSF PNFPADLLSN SSSSSTSSEE TPTTEARGRK  300
RKRKWKDFFE RLMKEVIEKQ EELQRRFLEA IEKREQERVV REEAWRMQEM QRINREREIL  360
AQERSIAAAK DAAVMTFLQK IAEHQQQETI NLEPALNNNS ITVVPQQPVP QATPTSTPTP  420
QQAQTTTVPE APQVQPLVPQ LQQQQQIVVS NVEINKADNN GENLMMEASS SRWPKVEVQA  480
LINLRTSLET KYQESGPKGP LWEEISALMR KMGYNRNAKR CKEKWENINK YFKKVKESNK  540
KRPEDSKTCP YFHQLEALYR EKNKGEGQMK PESMMAPLMV QPEQQWPPQT TLVVPPEVTM  600
GDTQNDPMDR QYHEENEDDE DDKEIGDEDE DEDDEGGDNY EIVASKPATA DASGE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298303RKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.616780.0leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G167600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548114.10.0trihelix transcription factor GT-2
TrEMBLK7MHS20.0K7MHS2_SOYBN; Uncharacterized protein
STRINGGLYMA16G28250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-62Trihelix family protein