PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G167500.1.p
Common NameGLYMA_16G167500, LOC100776819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Trihelix
Protein Properties Length: 617aa    MW: 69480 Da    PI: 6.2351
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G167500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix926e-2977160186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          rW++qe+laL+++r++m++ +r+++lk+plWeevs+k++e g++rs+k+Ckek+en+ k+ k++k++++++   + +t+++fdql+
  Glyma.16G167500.1.p  77 RWPRQETLALLKIRSDMDTVFRDSSLKGPLWEEVSRKLAELGYQRSAKKCKEKFENVYKYNKRTKDNKSGK--SHGKTYKFFDQLQ 160
                          8*****************************************************************99996..55567******98 PP

2trihelix102.82.6e-32436521187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k ev+aLi++r+++e++++++  k+plWe++s++m++ g++rs+k+Ckekwen+nk++k+++e++k+r  e+s+tcpyf++lea
  Glyma.16G167500.1.p 436 RWPKAEVHALIRIRTSLETKYQENGPKAPLWEDISIAMQRLGYNRSAKRCKEKWENINKYFKRVRESSKER-REDSKTCPYFHELEA 521
                          8*********************************************************************8.78999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.92270134IPR017877Myb-like domain
SMARTSM007170.1374136IPR001005SANT/Myb domain
PfamPF138374.0E-1976162No hitNo description
CDDcd122034.38E-2476141No hitNo description
PROSITE profilePS500906.829429493IPR017877Myb-like domain
SMARTSM007170.52433495IPR001005SANT/Myb domain
PfamPF138378.8E-22435522No hitNo description
CDDcd122036.99E-26435500No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MQLGDSSVLE ISSHTQPEMA VTAVVSPPEE VAHDGSDNSG DGGSGDGGGG EMIGMDLDAN  60
SGEGNEGNNK MSFGGNRWPR QETLALLKIR SDMDTVFRDS SLKGPLWEEV SRKLAELGYQ  120
RSAKKCKEKF ENVYKYNKRT KDNKSGKSHG KTYKFFDQLQ ALENQFTTVS YPPKPQPTST  180
LATTNPLTLP TRPSDHGNKV ISYVTTFPST NPTLISPSPQ TNTTTTTTTT TSTTNPRDSS  240
RPQTNNNNNS VTHSLPNMNT SFSTTTASTS SSTASDEDLE ERYRRKRKWK DYFRRLTRKV  300
LLKQEEMQKK FLEAMDQRER ERVAQQDNWR MQEMARINRE HEILVQERST AAAKDATVIA  360
LLQKMYGQQN PTPQVEVEPP PQQKQTIPQS QPPILMPNNN FEVKKINNGH SVTSTTTGTV  420
ATATTTTSPV NSSSSRWPKA EVHALIRIRT SLETKYQENG PKAPLWEDIS IAMQRLGYNR  480
SAKRCKEKWE NINKYFKRVR ESSKERREDS KTCPYFHELE ALYKEKSKSS KNPFGIFQNM  540
KPNEMMLMMT EPLMVQPEQQ WRPPPQSLEE GVGMENASEE YHENEENGGD DDDNIEEDGD  600
SVEDEGANPC EIATNN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.606830.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G167500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548983.20.0trihelix transcription factor GT-2
SwissprotQ391171e-137TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLI1MP720.0I1MP72_SOYBN; Uncharacterized protein
STRINGGLYMA16G28240.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-117Trihelix family protein