PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G145000.1.p
Common NameGLYMA_16G145000, LOC778099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 237aa    MW: 24624 Da    PI: 8.6883
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G145000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-382685362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          ++l+cprCds+ntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Glyma.16G145000.1.p 26 PENLPCPRCDSANTKFCYYNNYNYSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 85
                         57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272283IPR003851Zinc finger, Dof-type
PfamPF027017.5E-332883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1062983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MPSSNSGESR RASKPHRSVA APPVEPENLP CPRCDSANTK FCYYNNYNYS QPRHFCKSCR  60
RYWTHGGTLR DIPVGGGSRK NAKRSRTHHA AAATSSSSST SSATTSAHEH HNAHTLTALA  120
PVTAATHFGH DGDVKQTNGN ACGSYTSLLN NTQGSGFFAL GGFGLGLGHG FDDMGFGIGR  180
SGWAFPGMVD NGNIGGAIAS SGVNTWQLES GEGGFVGGDC FSWPGLAIST PGNGLK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286730.0meristem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:8718629}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G145000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572517e-96DQ857251.1 Glycine max Dof2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548014.11e-174dof zinc finger protein DOF3.4
RefseqXP_028206076.11e-174dof zinc finger protein DOF3.4-like
SwissprotQ390887e-58DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A445GIM21e-173A0A445GIM2_GLYSO; Dof zinc finger protein DOF3.4
TrEMBLI1MNL41e-173I1MNL4_SOYBN; Uncharacterized protein
STRINGGLYMA16G26030.11e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.12e-50OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]