PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G097400.1.p
Common NameGLYMA_16G097400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 217aa    MW: 24509.2 Da    PI: 7.5976
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G097400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP58.81.4e-18173216144
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44 
                          +Cq+egC+adls+ak+yh+rhkvCe+hska++v+++gl+qr Cq
  Glyma.16G097400.1.p 173 RCQAEGCNADLSQAKHYHHRHKVCEFHSKAATVIAAGLTQRLCQ 216
                          6******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-19169216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.289171216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-17172216IPR004333Transcription factor, SBP-box
PfamPF031104.9E-13174216IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MLTRNEDSSA TASDQTHRQI FDHYASNTFI PNHFLHAPMH STATTVATTT VDFTHSHFNP  60
QPHHHNQMNH HQHHHAFFDP RAFHDASNTS YPHPLPCFHL THCLTNGPEP YRLLLVPKSE  120
EVGWPMDFVG SRIGLNMGGR TYFSSSEDDF VSRLYRRSRP VEPGSTILSN SPRCQAEGCN  180
ADLSQAKHYH HRHKVCEFHS KAATVIAAGL TQRLCQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.107871e-135flower| hypocotyl| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G097400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530168.11e-105squamosa promoter-binding-like protein 8
TrEMBLA0A0R0FW551e-160A0A0R0FW55_SOYBN; Uncharacterized protein
STRINGGLYMA16G19464.11e-113(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.23e-48squamosa promoter binding protein-like 8