PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G054500.1.p
Common NameGLYMA_16G054500, LOC100792071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 366aa    MW: 40583.6 Da    PI: 7.4812
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G054500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.56.1e-4174151178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +C v+gC++dls+++eyhrrh+vCe+hsk+pvv+v g++qrfCqqCsrfh+l efDe krsCr+rL++hn+rrrk+q+
  Glyma.16G054500.1.p  74 CCSVDGCNSDLSDCREYHRRHRVCEKHSKTPVVMVGGKQQRFCQQCSRFHSLGEFDEVKRSCRKRLDGHNRRRRKPQP 151
                          6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.1E-3369136IPR004333Transcription factor, SBP-box
PROSITE profilePS511413272149IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3873154IPR004333Transcription factor, SBP-box
PfamPF031104.0E-3175148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDWDGKEFAW DPRGLELANG EGQKSEAASV DLRLGEEKTA PDVVAKDTKD SKTVSSPSGS  60
SKRSRLQNGL QNMCCSVDGC NSDLSDCREY HRRHRVCEKH SKTPVVMVGG KQQRFCQQCS  120
RFHSLGEFDE VKRSCRKRLD GHNRRRRKPQ PPSLFMAAEK FMYNYKGPRI LHFGSPEAYA  180
NPIMRDMWPA AAKTGAESGH DSPRLLYRID KHKQDKGHPL WQENDPKVGS GDEAMPGTPI  240
CQPIHGTIAP SMGGKSNRKL STDAKPGSFD SGCALYLLST LQSQSPELSM VQSSITCPVQ  300
SPSGSVHFDA VNEYACSETE RDKPSGQVLV FDAKTTNLHY NGMLQMDLDG FVENEDPLAL  360
PFLWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-27751481184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131148KRSCRKRLDGHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.259530.0root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G054500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0937510.0BT093751.1 Soybean clone JCVI-FLGm-17B4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549130.10.0teosinte glume architecture 1
RefseqXP_006599016.10.0teosinte glume architecture 1
RefseqXP_006599017.10.0teosinte glume architecture 1
RefseqXP_028207755.10.0teosinte glume architecture 1-like
RefseqXP_028207756.10.0teosinte glume architecture 1-like
RefseqXP_028207757.10.0teosinte glume architecture 1-like
TrEMBLA0A0B2R3R10.0A0A0B2R3R1_GLYSO; Squamosa promoter-binding-like protein 16
TrEMBLK7MFC40.0K7MFC4_SOYBN; Uncharacterized protein
STRINGGLYMA16G05895.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100312640
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-43SBP family protein