PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.16G017400.1.p
Common NameGLYMA_16G017400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 751aa    MW: 82412.4 Da    PI: 6.1955
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.16G017400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-162468147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Glyma.16G017400.1.p 24 RERWTEEEHNRFLEALKLHGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-161874IPR009057Homeodomain-like
PROSITE profilePS5129420.2261973IPR017930Myb domain
TIGRFAMsTIGR015579.7E-162271IPR006447Myb domain, plants
SMARTSM007171.3E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-82364IPR009057Homeodomain-like
PfamPF002491.8E-132467IPR001005SANT/Myb domain
CDDcd001671.46E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MDAYSSGEEV VVKTRKPYTI TKQRERWTEE EHNRFLEALK LHGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFT KLEKEALVKG VPIGQALDID IPPPRPKRKP NNPYPRKTRI GTTSLHSGAK  120
DGKLNLVESS HVNQALDLKK EPLPEKHDLD EGLTTVKENK DENHAKVFTL LQEVPCSSVS  180
SANESSITMS VPLGNPCAFK EITPSVKEVI ARDEKTESFV TVEPENGKLE INDGKQTNGT  240
SKDSRLEDSD ALHMKLVQNE KPDGLDCELT IDGMQGNQNY PRHVTVHVVD GNLGTNTQNP  300
SQDMLFRDSM FQPIGGVNGQ RNVFTNTAPS NTSESQNNTA RSSVHQSFLP YPPFTQHNQD  360
DYQSFLHMSS TFSNLIVSTL MQNPAAHAAA SFAATFWPYA NPETSANSPR CSQGGFTNRQ  420
IGSPPSVAAI AAATVAAATA WWAAHGLLPL CAPLHTSFAC PASVTTVPSM NTGEAPALKA  480
EQEKTTLQNP PLQDQMLDPE YSEAQQAQHS ASKSPAAILS DSESGDAKLN TSSKVTDHET  540
NKTISEHLDS NKTKGRKPVD RSSCGSNTAS SSDVETDALE KGEKGKEEPE IPDANQLAIE  600
FSNRRRSVSN LTDSWKEVSE EGRLAFQALF SREVLPQSFS PPHALKNTDH QMDNANDNKQ  660
NIDDKDEDLD GSKKCSSNYE AMQKNLLFVE NNEGLLTIGL GQGKLKTHRT GFKPYKRCSM  720
EAKENRVGAS SNQGEEQGCK RIRLEGETST *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.325830.0cotyledon| flower| hypocotyl| leaf| meristem| pod| root| seed coat| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.16G017400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0764330.0EU076433.1 Glycine max late elongated hypocotyl and circadian clock associated-1-like protein 1 (LCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235187.20.0late elongated hypocotyl and circadian clock associated-1-like protein 1
RefseqXP_006598675.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_006598678.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623886.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623887.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623888.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623889.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623890.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623891.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
RefseqXP_014623892.10.0late elongated hypocotyl and circadian clock associated-1-like protein 1 isoform X1
TrEMBLI1MKB10.0I1MKB1_SOYBN; Uncharacterized protein
STRINGGLYMA16G01980.80.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Representative plantOGRP9903510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-134MYB_related family protein
Publications ? help Back to Top
  1. Liu H, et al.
    Analysis of clock gene homologs using unifoliolates as target organs in soybean (Glycine max).
    J. Plant Physiol., 2009. 166(3): p. 278-89
    [PMID:18707796]