PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G269100.1.p
Common NameGLYMA_15G269100, LOC100778742
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 385aa    MW: 42520.7 Da    PI: 5.8035
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G269100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.4e-18202256256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++++++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  Glyma.15G269100.1.p 202 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTK 256
                          778899***********************************************98 PP

2HD-ZIP_I/II128.72.5e-41202292192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+++L+p++K +la++L+lqprqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +
  Glyma.15G269100.1.p 202 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-A 290
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Glyma.15G269100.1.p 291 LK 292
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-18177259IPR009057Homeodomain-like
SuperFamilySSF466893.72E-19187259IPR009057Homeodomain-like
PROSITE profilePS5007117.281198258IPR001356Homeobox domain
SMARTSM003893.4E-16200262IPR001356Homeobox domain
CDDcd000862.45E-16202259No hitNo description
PfamPF000463.4E-15202256IPR001356Homeobox domain
PROSITE patternPS000270233256IPR017970Homeobox, conserved site
CDDcd146860.00622251290No hitNo description
PfamPF021836.0E-11258292IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26258301IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MELGLSLGDS SRPLLGFMEK PREASNQLGL GFNTTLSIGP IITTHKDHQQ DEDEEYQEEE  60
EEETKPKNNN THRIQGPDGL SSNPNNNNNT VLHQLDLLPQ LALPWHPPSE NGSLSSELGG  120
SSRGLDVNAQ PPAVEDEAEE AAALSSSPNS AASSFQMDLC IYSSRGGSSY KRDFEGEAYD  180
QRTSSRASDD DDNNNGSGGN TRKKLRLSKE QSAFLEESFK EHNTLNPKQK LALAKQLNLQ  240
PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR LHKELQELRA LKTSNPFYMQ  300
LPATTLTMCP SCERVATNST STSLSISATI NATNSGAMAS VKTSNNNNNN DSPSKAIGFP  360
FGKPRFHPFV HTSQQPHQHQ STAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200206TRKKLRL
2250258RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.518880.0hypocotyl| somatic embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G269100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546861.10.0homeobox-leucine zipper protein HOX11
SwissprotA2YW031e-90HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLI1MJJ60.0I1MJJ6_SOYBN; Uncharacterized protein
STRINGGLYMA15G42380.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-59homeobox from Arabidopsis thaliana