PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G215500.1.p
Common NameGLYMA_15G215500, LOC102666857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 467aa    MW: 52081.6 Da    PI: 7.3277
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G215500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.7e-38103163262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rn+PvG+g+rknk+s 
  Glyma.15G215500.1.p 103 PDKVLPCPRCNSLETKFCYFNNYNVNQPRHFCKNCQRYWTAGGTIRNIPVGTGKRKNKHSA 163
                          78999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-28100160IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31104161IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.351107161IPR003851Zinc finger, Dof-type
PROSITE patternPS013610109145IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MVMPFNPPLL FHFHSRDLFL LTCCSFSCES FSNGLEESTN NEVDVPLNEV SNKLIDPHKY  60
GYGTPNLNKN TTLKLVPKVV HRTNEHRNAK REIDHQEKVF KKPDKVLPCP RCNSLETKFC  120
YFNNYNVNQP RHFCKNCQRY WTAGGTIRNI PVGTGKRKNK HSAQYCQIPM TPDAASVIQT  180
DSKPASDMLL LSNELPVTSR PIKGGEETPL SESLETVLSL NGLTKIEVDS STLKDDDDEE  240
PSSSSMRSSE IEQLGLPQHS NGLVPLHSFH YYHVPSWPYQ WNPCWNVKEF RPSNISSRAV  300
YTDSSTMMAV PGFSIPTVIL PGVPYSYLGF MSSWAEQKEE ASLVGSAFSG ISLSSCSVSN  360
STCSGNRSPT LGKHPRDGST PGEDAMKQNL WVPKTVRIND PEEAANSSIW STLGTKSEQN  420
KFIMKGSVFK SFEPKSQASP HILDDNQILR ANPAAFSRSE SFQERM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G215500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006598004.10.0cyclic dof factor 3 isoform X1
TrEMBLK7MCW10.0K7MCW1_SOYBN; Uncharacterized protein
STRINGGLYMA15G29870.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-55cycling DOF factor 2