PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G206200.1.p
Common NameGLYMA_15G206200, LOC100776075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 702aa    MW: 76856.1 Da    PI: 6.1364
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G206200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.2e-29206259155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Glyma.15G206200.1.p 206 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 259
                          79*******************.********************************8 PP

2Response_reg83.66e-28211291109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+p+ +++l+++l+k +y +v+++ ++ eal++l+e++  +Dl++ D++mp++dG++ll+     e++lp+i+++ahg+ +++ +
  Glyma.15G206200.1.p  21 VLAVDDDPICLKVLENLLRKCQY-HVTTTNQAVEALKMLRENRnkFDLVISDVNMPDIDGFKLLELVGL-EMDLPVIMLSAHGDTKLVMK 108
                          799********************.***************999889*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l Kp+ +eel +
  Glyma.15G206200.1.p 109 GVTHGACDYLLKPVRIEELKN 129
                          ******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.9E-1641700IPR017053Response regulator B-type, plant
SuperFamilySSF521724.13E-3618142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.5E-4318152No hitNo description
SMARTSM004487.8E-3419131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.03820135IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2521129IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.57E-2922134No hitNo description
Gene3DG3DSA:1.10.10.601.7E-30203263IPR009057Homeodomain-like
PROSITE profilePS5129412.009203262IPR017930Myb domain
SuperFamilySSF466895.73E-20204263IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25206259IPR006447Myb domain, plants
PfamPF002491.2E-7208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MAVEKQREDE GCDRFPVGMR VLAVDDDPIC LKVLENLLRK CQYHVTTTNQ AVEALKMLRE  60
NRNKFDLVIS DVNMPDIDGF KLLELVGLEM DLPVIMLSAH GDTKLVMKGV THGACDYLLK  120
PVRIEELKNI WQHVVRRKNF DSRDQNKASN EEKAPNIAGE GSQGLRSENS ADQNKRLGKK  180
RKDQSEEEEE DGEENGDDED PSAQKKPRVV WSVELHRKFV AAVNQLGLDK AVPKKILDLM  240
NVEGLTRENV ASHLQKYRLY LKKAAQQANM VAALGGSDSY LRMGSIDGYG DFCTSSGSGR  300
ITNTTSPSYA STGIFSRLNS PAALNMRAIS SSALIRPVQS QNINCSLNTL GNIQPSVFPA  360
NHSSSLLQGI PTSIELNQSK QSNCTTGISQ LSQVDSSGFA VASGFPDSRA TVNGPNNSLP  420
CVSNNHIMLQ GNPQQMHGPG AFRNQSSVRA ASLCAESFDA GLCSSSNLLD YNRCNENWQN  480
AAQLSKFPAH SLPLCEAFSN DQLPPTRINV SNSRTHIVNS PVDFSSRMGI SVPLEDTRNE  540
LACQEGLIGN IVKPSSYTPQ QRWEEHKLDY NQNVGHSFNP VNSHASSSGV KSSMGHGLNQ  600
NNTICSNRVD ASLVGQLNGA SPSISRCTEV EKFSSDIRLK PNEAYILEQM KSQDGFMQNT  660
FGTLDDIMGA MVKRTTMQEQ NELTLLDGEM GFDAYPVGSC N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-25202265164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182KRLGKKRKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.554130.0hypocotyl
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G206200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0942040.0BT094204.1 Soybean clone JCVI-FLGm-18G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014623661.10.0two-component response regulator ARR12 isoform X1
SwissprotQ6K8X61e-142ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A0R0G3R50.0A0A0R0G3R5_SOYBN; Uncharacterized protein
STRINGGLYMA15G24770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-129response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]