PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G190200.2.p
Common NameGLYMA_15G190200, LOC100792774
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 1033aa    MW: 114474 Da    PI: 7.0491
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G190200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71.1e-40147224178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+adls++k+yhrrhkvC++hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Glyma.15G190200.2.p 147 VCQVEDCRADLSNVKDYHRRHKVCDMHSKATQALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTHP 224
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-32142209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.24E-38146227IPR004333Transcription factor, SBP-box
PfamPF031106.7E-29148221IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.19E-6803918IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.4E-5804915IPR020683Ankyrin repeat-containing domain
CDDcd002041.82E-6804914No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1033 aa     Download sequence    Send to blast
MEARLEGKNQ YLYGPVVPEV KSVGKRTLEW DLNDWKWDGD LFTARQLNSV PSDCRSRELF  60
PADPEILVTG DASNNLSSAY DDVNLGEGKR ELEKRRRGVI DEGGVEMNDG AGSLNLNLGG  120
QVYPIMEGEE KSGKKTKLTA STSSRAVCQV EDCRADLSNV KDYHRRHKVC DMHSKATQAL  180
VGNVMQRFCQ QCSRFHVLQE FDEGKRSCRR RLAGHNKRRR KTHPDATVVN GGSLNEEKGS  240
SYLLMSLLRI LSNMHSNGSD NMRNQDVLSH LLRNLASLTG TINGRNIVSL LEGSQDLVKA  300
GTSGAAQNVP NTNSNGPEPS RPLYSSIKMD DGLIHRDPPE SLVQCETTPA NDMAKECIAS  360
GNDEVGSLKS PSVPLSTNVL LSMDSLPPQS IAAQTTVGRI GLSNIDLNNV YDDVQDYVEN  420
TRNCRPPLPS GNGSLDHPLL VQCDSLKSSP PQTSRNSDST STQSPSSSSG EAQSRTDRIV  480
FKLFGKAPND FPHALRSQIL NWLSHSPTEI ESYIRPGCIM LTIYLRLENS AWEELCYNLG  540
PSLRKLAASN DCFWRTGWIY TRVQHSVAFL YNGQVVLDAP LRLKSPQSCQ ILCVKPLAVS  600
ASSCAQFVLK GFNFLLSNSR LLCALEGKYL VQDNCYDLID SVDAANGHHE LQHLRFSCHV  660
PNVTGRGFIE VEDNGLSSCS FPFIVAEQEI CSEICKLENV IEAAETADDI QIKTKLMEEK  720
TQALYFIQEM GWLLHRSRVK VRLGPVAPVQ DNFHFNRFMW LVGFSMDHDW CAVMKKLLNI  780
VFEGTVDTGD HASVELALLE MGLLHKAVKR NFRPMVELLL KFVPVKASDG GDSNEKQINK  840
SPDRFLFRPD TVGPARLTPL HVAASMHGSE NVLDALTDDP GMVGSEAWKS AQDATGLTPY  900
DYASLRGYYS YIQLVQRKTS NTCKNQQHVL DIPGNLVDSN TKQKQSDGHR SSKVLSLQTE  960
KIETTAMRHC GLCQQKLVYG GMRRALVFRP AMLSMVAIAA VCVCVALLFK SSPKVYYVFQ  1020
PFSWESLEYG SI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29139221284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216222KRRRKTH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.392890.0hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G190200.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014623368.10.0squamosa promoter-binding-like protein 12
RefseqXP_025981528.10.0squamosa promoter-binding-like protein 12
TrEMBLI1MHQ90.0I1MHQ9_SOYBN; Uncharacterized protein
STRINGGLYMA15G21860.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12