PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G168800.1.p
Common NameGlyma15g18320.1, LOC100778922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25323.9 Da    PI: 7.3412
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G168800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.2e-1988142256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq  +Le+ F+ ++ ++ ++++ LA++l+L+ rqV vWFqNrRa+ k
  Glyma.15G168800.1.p  88 RKKLKLTKEQSATLEDIFKLHSSLNPAQKQALAEQLNLKHRQVEVWFQNRRARTK 142
                          788899***********************************************98 PP

2HD-ZIP_I/II115.92.4e-3788177190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk++l+keq+++LE+ F+ ++ L+p +K++la++L+l+ rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en rL+ke +eLr++
  Glyma.15G168800.1.p  88 RKKLKLTKEQSATLEDIFKLHSSLNPAQKQALAEQLNLKHRQVEVWFQNRRARTKLKQTEVDCEFLKKCCEKLTDENLRLKKELQELRAQ 177
                          69*************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1873138IPR009057Homeodomain-like
SuperFamilySSF466891.45E-1875145IPR009057Homeodomain-like
PROSITE profilePS5007116.94184144IPR001356Homeobox domain
SMARTSM003892.7E-1586148IPR001356Homeobox domain
PfamPF000463.0E-1688142IPR001356Homeobox domain
CDDcd000861.80E-1588145No hitNo description
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
SMARTSM003401.9E-20144187IPR003106Leucine zipper, homeobox-associated
PfamPF021832.8E-9144178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MEDDEACITS LSLGLGIMGG HAPKKENKQK VPCLDLSFEL CPKGEEEEEE AIDVDQQQHG  60
DKAKGLLCLK HPNDETSPDS NNSNNGSRKK LKLTKEQSAT LEDIFKLHSS LNPAQKQALA  120
EQLNLKHRQV EVWFQNRRAR TKLKQTEVDC EFLKKCCEKL TDENLRLKKE LQELRAQKIG  180
STPLYIQLSK ATTLTICSSC EKLLKPNEGN KGAINKLQNS IELGGI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.521250.0somatic embryo
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G168800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311720.0KT031172.1 Glycine max clone HN_CCL_117 homeodomain/HOMEOBOX transcription factor (Glyma15g18320.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546451.11e-163homeobox-leucine zipper protein HOX17
SwissprotP466041e-52HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0K2CTK41e-162A0A0K2CTK4_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1MH621e-162I1MH62_SOYBN; Uncharacterized protein
STRINGGLYMA15G18320.11e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.15e-55HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]