PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G145200.1.p
Common NameGLYMA_15G145200, LOC100809583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 673aa    MW: 73650.7 Da    PI: 6.3622
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G145200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.7e-28207260155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++F+ av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Glyma.15G145200.1.p 207 KPRVVWSVELHQQFMAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 260
                          79*******************.********************************8 PP

2Response_reg74.54.1e-25311391109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl+vdD+p+ +++l+++l+   y ev+ ++ +e al ll+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a + +  + +
  Glyma.15G145200.1.p  31 VLVVDDDPTCLMILERMLRACLY-EVTKCQRAEVALSLLRENKngFDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKHVVMK 118
                          89*****************9999.***************999999**********************6654.8***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l Kp+ +e+l +
  Glyma.15G145200.1.p 119 GVTHGACDYLIKPVRIEALKN 139
                          *****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1765664IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.8E-4128172No hitNo description
SuperFamilySSF521724.84E-3528149IPR011006CheY-like superfamily
SMARTSM004481.2E-2929141IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.10630145IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2231139IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.07E-2732145No hitNo description
SuperFamilySSF466895.02E-20204264IPR009057Homeodomain-like
PROSITE profilePS5129410.888204263IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-30206265IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24207260IPR006447Myb domain, plants
PfamPF002492.4E-7209259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MNLSNGKGST SSSPLKAGDS VSDQFPAGLR VLVVDDDPTC LMILERMLRA CLYEVTKCQR  60
AEVALSLLRE NKNGFDIVLS DVHMPDMDGF KLLEHIGLEM DLPVIMMSAD DGKHVVMKGV  120
THGACDYLIK PVRIEALKNI WQHVIRKRKN GLRDVEQSGS VEEGDQPPKV SDDGDYSSSV  180
NEARSSKKRR DEDEEGDEKD DSSTLKKPRV VWSVELHQQF MAAVNQLGID KAVPKKILEL  240
MNVPGLTREN VASHLQKYRL YLRRLSGVSQ QQGNLNNSFM SSQEATFGGT SINGIDLQTL  300
SAAGQFPSQS LAKLQATGLG RTTAKAGVPM PLSDQKNLFS FENPRLRFGE GSLQHLSNSK  360
PINLLHGIPT NMEPKQLANL HQSTQPLGSL NMRVNAPVTQ NNPLLMQMAQ SQPRGQMLGE  420
NAGSHVTRFP SSLVQPTVSN GISNGVLGNG IAGTSNITTY NPVQQNSSLL SFPMNQTNEI  480
SVSNFPLRSS PGITSITNKG MFHEEGTSGI KGPGGFVQGY DMFNELHHQK SHDWDLTNTG  540
MTYDAAHHAN PLQGNIDVSP SVLVHQSFPT MHQTVQNRDT TSIGKAMFST GEGMHQSNLQ  600
NVGQHHNNLL LDNSVRVKAE RIPDPSCQIN NLFADQYGQE DLVSAFLKQQ ESIGTSENEF  660
DFDGYSLDNI PV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22206266464ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.196390.0flower| root| seed coat
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:9891419}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G145200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546340.10.0two-component response regulator ARR2
RefseqXP_028204398.10.0two-component response regulator ARR2-like isoform X1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A445GTV50.0A0A445GTV5_GLYSO; Two-component response regulator
TrEMBLI1MGI90.0I1MGI9_SOYBN; Two-component response regulator
STRINGGLYMA15G15520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]