PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G141400.1.p
Common NameGLYMA_15G141400, LOC100798926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 594aa    MW: 67365.8 Da    PI: 4.554
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G141400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.44e-952205912374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselyk.al.ppsetsekn.sseelaalklfsevs 88 
                           e Ll+cAe v ++++e+a++lL++ + l+s++g+p++R+++yf+eAL++r+  ++ ++++  l + ++ ++++  +e + a  +f+e  
  Glyma.15G141400.1.p 220 AESLLACAEKVGNKQFERASKLLSHCESLSSKTGNPVKRIVHYFAEALRQRIDTETGRVSSkDLqKGQPFDPEEaAKELTPAILAFVEDL 309
                          578**************************************************96666654145455555555546666667777***** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                          P+ k++++ta qaI e v++++r+HiiD++i +G+QW   +qaL  R e p   l+iT+v+s +   ++  e tg+rL+++A+ l++pf+
  Glyma.15G141400.1.p 310 PFCKVAQFTAAQAIIEDVAEAKRIHIIDLEIRKGGQWTIVMQALQLRHECPIeLLKITAVESGT--TRHIAEDTGQRLKDYAQGLNIPFS 397
                          ************************************************7665499*******44..89999******************* PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          fn+++++ +  l+ + ++++p+E++aV + + l + l++s +le     ++++++++sP+v+vv+e ea+hns+sF++rf+eal  +sa+
  Glyma.15G141400.1.p 398 FNIVMVSGMLHLREDLFEIDPEETIAVYSPYCLRTKLQQSDQLET----IMRVIRTISPDVMVVAEIEANHNSKSFVNRFVEALFSFSAF 483
                          ***********************************9988888888....***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                          fd++ea +  ++++r+ +E +++++ i+n+va+egaerr r  +   Wr+ ++++G+++ +ls+    qa+l+ ++++ ++  + e + +
  Glyma.15G141400.1.p 484 FDCFEACMKGDEKNRMIIESMYFSPGIRNIVAAEGAERRSRSVKIDVWRAFFSRFGMEEKELSTLSLYQAELVAKRFPcGNFCTFERNGH 573
                          ******************************************************************************888788899999 PP

                 GRAS 357 slvlgWkdrpLvsvSaWr 374
                          +l++gWk+ p+ svS+W+
  Glyma.15G141400.1.p 574 CLLIGWKGTPINSVSVWK 591
                          999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.492193570IPR005202Transcription factor GRAS
PfamPF035141.4E-92220591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MDDLYYAGFS TDDNSSSSND FFWDNEGLND VRKFQFSGVE DHEEYGGIDS FYSNFGFFPD  60
DPSEEGYLLS TNHQKYHQIF DDYGLLDDNL QFDMVSPPLQ FDEQYRTMVP LCNSTKDMPH  120
STTPLASLEI LKSYGKGFKR FWNEGNNTMQ PIDDETLATD EVIAGRNLST EDLMRIAGTR  180
FIQSSSSSSD SESLPFLENH PFGFSFSGFS DEEKEDLELA ESLLACAEKV GNKQFERASK  240
LLSHCESLSS KTGNPVKRIV HYFAEALRQR IDTETGRVSS KDLQKGQPFD PEEAAKELTP  300
AILAFVEDLP FCKVAQFTAA QAIIEDVAEA KRIHIIDLEI RKGGQWTIVM QALQLRHECP  360
IELLKITAVE SGTTRHIAED TGQRLKDYAQ GLNIPFSFNI VMVSGMLHLR EDLFEIDPEE  420
TIAVYSPYCL RTKLQQSDQL ETIMRVIRTI SPDVMVVAEI EANHNSKSFV NRFVEALFSF  480
SAFFDCFEAC MKGDEKNRMI IESMYFSPGI RNIVAAEGAE RRSRSVKIDV WRAFFSRFGM  540
EEKELSTLSL YQAELVAKRF PCGNFCTFER NGHCLLIGWK GTPINSVSVW KFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-412215916375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546321.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A0B2Q4E00.0A0A0B2Q4E0_GLYSO; DELLA protein RGL2
TrEMBLI1MGF60.0I1MGF6_SOYBN; Uncharacterized protein
STRINGGLYMA15G15110.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-51RGA-like 2