PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G116300.1.p
Common NameGLYMA_15G116300, LOC100819190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 553aa    MW: 61690.3 Da    PI: 5.8372
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G116300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS414.69.2e-1271795501374
                 GRAS   1 lvelLlecAeavssgdlelaqalLar.lselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          l+e+L++cA+av+++d e a  ++++ l +++s  gdp+qRl ay++e+L+arl +s+s +ykal++++ +   s + +++++++++++P
  Glyma.15G116300.1.p 179 LKEVLIRCAQAVADDDIETAVGFMNNvLAKMVSVGGDPIQRLGAYMLEGLRARLESSGSIIYKALKCEQPT---SNDLMTYMHILYQICP 265
                          5789********************872566799999**********************************9...89999999******** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                          + kf++  aN  I ea+ +e+r+ iiDf+i qG+QW+ L+qaLasRp+gpp + +Tgv++++s+  +   l+ +g+rL+++A+++gvpfe
  Glyma.15G116300.1.p 266 YWKFAYTSANAVIGEAMLNESRIRIIDFQIAQGTQWLLLIQALASRPGGPPFVHVTGVDDSQSFhaRGGGLHIVGKRLSDYAKSCGVPFE 355
                          ************************************************************9999889999******************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          f+  +a   +++ele+L ++pgEal+Vn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n+++F++rf+e+l+yy+a+
  Glyma.15G116300.1.p 356 FHS-AAMCGSEVELENLVIQPGEALVVNFPFVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTLVEQESNTNTSPFFQRFAETLSYYTAM 444
                          ***.899*********************************************************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          f+s+++ lpr++++ri+ E+++++r+ivn+vaceg+er+erhe l+kWr+r+++aGF p pls+ +++ ++ +l++++++ yr+e ++g+
  Glyma.15G116300.1.p 445 FESIDVALPRDDKQRINAEQHCVARDIVNMVACEGDERVERHELLGKWRSRFSMAGFAPCPLSSLVTDAVRNMLNEFNEN-YRLEYRDGA 533
                          ******************************************************************************55.********* PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l+lgWk+r++ + SaWr
  Glyma.15G116300.1.p 534 LYLGWKNRAMCTSSAWR 550
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.922153531IPR005202Transcription factor GRAS
PfamPF035143.2E-124179550IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MQTSQKHPTS AGIHLYHQPA QDIDPYTHYQ ILQSNSCHEI HDNSSSQGTT ISFETSKDQY  60
FTLESSPVIN DLIGCDSPSY ASVSSNRSPF SPQASHSYHS DQHQSSDNTY GSPTSSHSTA  120
DDSYELKNKL RELEISLLGP DSDIVDSCHC SYKGGCHGAS PMAKYNWDQI VEMIPKLNLK  180
EVLIRCAQAV ADDDIETAVG FMNNVLAKMV SVGGDPIQRL GAYMLEGLRA RLESSGSIIY  240
KALKCEQPTS NDLMTYMHIL YQICPYWKFA YTSANAVIGE AMLNESRIRI IDFQIAQGTQ  300
WLLLIQALAS RPGGPPFVHV TGVDDSQSFH ARGGGLHIVG KRLSDYAKSC GVPFEFHSAA  360
MCGSEVELEN LVIQPGEALV VNFPFVLHHM PDESVSTENH RDRLLRLVKS LSPKVVTLVE  420
QESNTNTSPF FQRFAETLSY YTAMFESIDV ALPRDDKQRI NAEQHCVARD IVNMVACEGD  480
ERVERHELLG KWRSRFSMAG FAPCPLSSLV TDAVRNMLNE FNENYRLEYR DGALYLGWKN  540
RAMCTSSAWR CY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-601835508375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.256480.0flower| leaf| pod| root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003546192.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A0B2RKU00.0A0A0B2RKU0_GLYSO; Scarecrow-like protein 13
TrEMBLI1MFQ00.0I1MFQ0_SOYBN; Uncharacterized protein
STRINGGLYMA15G12320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13