PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G099400.1.p
Common NameGLYMA_15G099400, LOC100819905
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 792aa    MW: 88244.3 Da    PI: 6.1094
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G099400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1179.8e-37115191177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv+gCead+se+k yhrrh+vC  +++a++v+++++ +r+CqqC++fh ls+fDe+krsCrr+L++hn rrr+k 
  Glyma.15G099400.1.p 115 RCQVPGCEADISELKGYHRRHRVCLRCANAATVMLNDEAKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNTRRRRKP 191
                          6************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-28110177IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.231113190IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-33114192IPR004333Transcription factor, SBP-box
PfamPF031107.2E-27116190IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MEPQSLPPPP TMDDAQDPSS IWDFSYLLDF NLDDQDGIFT SSNSLPLPLN DDDDAAAPEI  60
SQNDRVRKRD PRMTCSNFLA GRVPCACPEL DAKLEDEGLP VKKRARTARA SASARCQVPG  120
CEADISELKG YHRRHRVCLR CANAATVMLN DEAKRYCQQC GKFHVLSDFD EGKRSCRRKL  180
ERHNTRRRRK PPADSGGAAH SELLQPVAQN EEHNYHVEAG KDCSNLSTDV NDVGVSPDHE  240
DEPVSIPSLA PDHEDEPVSI PSLAPEAQNI NSDSVVSLAV SGEMRVNSGN TSNSPSYCNN  300
KNAYSSVCQT GRISFKLYDW NPAEFPRRLR HQIFQWLANM PVELEGYIRP GCTILTVFIA  360
MPNIMWITLL KDSLEYVHDF VAPGKMLSGR GTALVHLNDM IFRVMKDGTS VTKVEVNMLA  420
PRLHYVHPTY FEAGKPMEFV ACGSNLLQPK FRLLVSFSGK YLKCEYCVPS PHSWTEDNIS  480
CAFDNQLYKI YVPHTEESLF GPAFIEVENE SGLSNFIPVL IGDKEICTEM KTLQQKLDVS  540
LLSKQFQSAS GGSICSSCET FALSHTSSSD FLVDIAWLLK DTTSENFDRV MTASQIQRYC  600
HLLDFLICND STIILGKILP NLIILTESVE SNNVVINRTS DVDITQLLNH IHNASNVICQ  660
KHQQSRSIIV HSEMEGFKLA QGCSQDNMLS VAINSQGILS RTDEKWGVLK SPTSNDKTER  720
IPLLKRDIIM SVEELPERYG RRCLGRGFLT SRPAIFVIVS VAVCLGVCVA VLHPGRVSEL  780
AVSVRRCLFN Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-43114199488squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176188RRKLERHNTRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.341590.0seed coat| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G099400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547221.10.0squamosa promoter-binding-like protein 7 isoform X1
RefseqXP_028203738.10.0squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A445GRK20.0A0A445GRK2_GLYSO; Squamosa promoter-binding-like protein 7 isoform A
TrEMBLI1MF880.0I1MF88_SOYBN; Uncharacterized protein
STRINGGLYMA15G10620.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.30.0squamosa promoter binding protein-like 7