PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G076000.1.p
Common NameGLYMA_15G076000, LOC100801049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 354aa    MW: 38023.2 Da    PI: 8.5557
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G076000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38e-3955115262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          + ++lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+r+nk+++
  Glyma.15G076000.1.p  55 HPETLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRRNKRVK 115
                          57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2857113IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3358113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51659113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MSANCEKMVA IPPTTNQWLQ VDDHKVLMGS NGGSSNNNKV MEKPGQNQLV QQQQHPETLK  60
CPRCDSSNTK FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRR NKRVKRPITS  120
PCSAAIDTAS NSSNSSSAPT AAASLQPQID TASTSNHINP LFYGLPSSSS DVNLPLFSRF  180
GSRISSSGFD LQLNNALGLG FSSGVLSNEA SDNNGYRSGF GSNNMLLSSY TSTTTTTPAM  240
SSLLLQQKFI SGGLKNDADS SNTFQHGLSL TSLEQLQIAS DHSSEAGMVA LKDVKVELGQ  300
NNNRLEWNGG AFQSQIQHVG LYDPLLYWNN SATALGVWND QAANIGSSVT SLI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286720.0epicotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G076000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545993.10.0dof zinc finger protein DOF1.4
RefseqXP_028202665.10.0dof zinc finger protein DOF1.4-like
TrEMBLA0A0B2QT260.0A0A0B2QT26_GLYSO; Dof zinc finger protein DOF1.4
TrEMBLI1MEK80.0I1MEK8_SOYBN; Uncharacterized protein
STRINGGLYMA15G08250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-39Dof family protein