PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G075800.1.p
Common NameGLYMA_15G075800, LOC100817065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 314aa    MW: 33801.3 Da    PI: 9.6657
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G075800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-383595262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +++ +kcprCds ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+++
  Glyma.15G075800.1.p 35 PQQPQKCPRCDSLNTKFCYYNNYSLSQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRAK 95
                         67899***************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.3E-333793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8353993IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-244093IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEQGVEEGGG MNKIPRDSRV KEIRQGDAQI QVQAPQQPQK CPRCDSLNTK FCYYNNYSLS  60
QPRYFCKTCR RYWTQGGTLR NVPVGGGCRK GKRAKSSNSS SSENMNSSSR SLPQQQQQPQ  120
GVVVQTQAPP LTTVVKAKDP SSVVASTFYQ SGGYLSSLAA MHSLNSSSHP FDHSLNFAGS  180
DTLRSSNLGL LSGFNVQRPI GPIRPPHLYH QMGSGEREMV SLYEQGLVNP SSSSMANTDT  240
NSSGVSQHDW PMSFINNNNN NASNRASDAS LWSTISTTVG GNAERTSPSG VGAGSSSFVK  300
NQWPNLPGYG PPP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G075800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352680.0AC235268.1 Glycine max strain Williams 82 clone GM_WBb0044I02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597450.10.0dof zinc finger protein DOF1.6
RefseqXP_028202866.10.0dof zinc finger protein DOF1.6-like
TrEMBLA0A445GQN90.0A0A445GQN9_GLYSO; Dof zinc finger protein DOF5.3
TrEMBLI1MEK70.0I1MEK7_SOYBN; Uncharacterized protein
STRINGGLYMA15G08230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-32TARGET OF MONOPTEROS 6