PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G071400.1.p
Common NameGLYMA_15G071400, LOC100806358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 286aa    MW: 31767.4 Da    PI: 7.2688
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G071400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.86.6e-3541100261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +++ lkcprCds ntkfCyynny+ sqPr++C+aC+r+WtkGG+lrnvPvGggr++++ +
  Glyma.15G071400.1.p  41 PSEPLKCPRCDSINTKFCYYNNYNKSQPRHYCRACKRHWTKGGTLRNVPVGGGRKNKRVK 100
                          67899***********************************************97766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-193489IPR003851Zinc finger, Dof-type
PfamPF027014.0E-314497IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.994599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGLSSKQVSN RGLDWNQTLL QAQNLELPNP PPMRKQQQTQ PSEPLKCPRC DSINTKFCYY  60
NNYNKSQPRH YCRACKRHWT KGGTLRNVPV GGGRKNKRVK KSTTPAIATT SISTSTSNAN  120
MDGELNNPIT IPSLAVDDHK TTPSSLYQYV CLPQQNLMST KDSEEGKDFG IGNGIFLSST  180
VPFPQSQSLL FPFTTSNSFD PNLCAISSSF RSSSVYNYGE EFKIMEEPTL NSIMPNTSGS  240
TNTQPWEIAA TSSGMEMSNY WTWEDIDSFV STDPNVPWDD SDIKP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.371220.0epicotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G071400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572760.0DQ857276.1 Glycine max Dof25 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545886.10.0dof zinc finger protein DOF3.4
RefseqXP_028202756.10.0dof zinc finger protein DOF3.4-like
TrEMBLA0A445GQB20.0A0A445GQB2_GLYSO; Dof zinc finger protein DOF5.3
TrEMBLI1MEF10.0I1MEF1_SOYBN; Uncharacterized protein
STRINGGLYMA15G07730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-24DOF zinc finger protein 1