PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G039600.1.p
Common NameGLYMA_15G039600, LOC100779632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 220aa    MW: 24907.9 Da    PI: 7.8429
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G039600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.4e-202483357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         +R+++tkeq++ Le+++++  r+ps+e++++++++l     ++ ++V++WFqN++a++++
  Glyma.15G039600.1.p 24 SRWSPTKEQIDMLENFYKQgIRTPSTEQIQQITSRLraygYIEGKNVFYWFQNHKARQRQ 83
                         6*****************99*******************99*****************97 PP

2Wus_type_Homeobox110.41e-352384364
    Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                          +RW+Pt+eQi +Le+ yk+G+rtP++e+iq+it++L++yG ie+kNVfyWFQN+kaR+rqk
  Glyma.15G039600.1.p 23 VSRWSPTKEQIDMLENFYKQGIRTPSTEQIQQITSRLRAYGYIEGKNVFYWFQNHKARQRQK 84
                         68***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1591984IPR001356Homeobox domain
SMARTSM003896.9E-62188IPR001356Homeobox domain
SuperFamilySSF466893.46E-122389IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-92483IPR009057Homeodomain-like
PfamPF000461.6E-172483IPR001356Homeobox domain
CDDcd000863.16E-62579No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MESHSTAEDE SGWKGSSGAH SSVSRWSPTK EQIDMLENFY KQGIRTPSTE QIQQITSRLR  60
AYGYIEGKNV FYWFQNHKAR QRQKLKQKQQ SIAYCNCFLH ASHPICQNVV CAPYCLQKSG  120
FSFYPHQPKV LASVGISSRI ETGSFGMLRI CDGMQSEHPD YNYSTSNREA LTLFPLHPTG  180
ILEEKTTHHS VDVTDKSFVS IAVDENGHLG NQPCFNFQY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.394360.0somatic embryo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G039600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0965100.0BT096510.1 Soybean clone JCVI-FLGm-15H19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547375.11e-167uncharacterized protein LOC100779632
TrEMBLI1MDG51e-165I1MDG5_SOYBN; Uncharacterized protein
STRINGGLYMA15G04460.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Representative plantOGRP85821116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-33WUSCHEL related homeobox 2