PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G039300.1.p
Common NameGLYMA_15G039300, LOC100775899
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 305aa    MW: 33103 Da    PI: 10.0933
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G039300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-3869127462
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  Glyma.15G039300.1.p  69 GVLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKHK 127
                          5689****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2854120IPR003851Zinc finger, Dof-type
PfamPF027016.6E-3370125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53471125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MVFSSIPVYS DPPNWQQQQQ NQHQANGINS PQLLSPLPQP PQAPHVGVEA GQTRSGPMAD  60
RAKIPAQEGV LKCPRCESTN TKFCYFNNYS LSQPRHFCKT CRRYWTRGGA LRNVPVGGGC  120
RRNKKHKRSR SKSPVSTDKP SLPNSTSAIP ELIGRFPQPF IASLQSMNRY GVGNTGVNLR  180
EIQAQNGSQM GFQIGGHGNG TSSVATAGGG VEQWRFQQFP FLNGFESTLA VSNSYPFQSE  240
SVEGLVGDIA ASSRATQLPA RVKMEYNGGL NLSRSPLSVS ENSNHYYSWT DLSGLVSSSA  300
SHLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.448950.0hypocotyl| meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.15G039300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547369.10.0dof zinc finger protein DOF3.6
RefseqXP_028202845.10.0dof zinc finger protein DOF3.6-like
TrEMBLA0A445GNZ80.0A0A445GNZ8_GLYSO; Dof zinc finger protein DOF3.6
TrEMBLI1MDG20.0I1MDG2_SOYBN; Uncharacterized protein
STRINGGLYMA15G04430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-40OBF-binding protein 3