PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G037200.1.p
Common NameGLYMA_15G037200, LOC100780343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 666aa    MW: 75136.7 Da    PI: 6.2772
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G037200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS359.84.1e-1102916623373
                 GRAS   3 elLlecAeavssgd.lelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          +lL+ cA+av+sg+  + a++l+ ++++++sp gd +qRla+yf +AL+arl +++ ++y+ l +s+ +  + ++ ++a++++  ++P+ 
  Glyma.15G037200.1.p 291 TLLMLCAQAVASGSsPSFAKQLVMQIKQHSSPIGDETQRLAHYFGNALEARLDGTGYQVYSVLLSSKRT--SAKDMVKAYRVYLSICPFE 378
                          689*********651579*******************************************99777766..49999************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k++ + aN+ I +  e ++++HiiDf+i +G++WpaL+  L+ Rp+gpp+lRiTg++ p++g   +e++ etg+rLa++++++++pfef+
  Glyma.15G037200.1.p 379 KLAVIFANNSICNLSEDAKTIHIIDFGIRYGFKWPALISRLSRRPGGPPKLRITGIDVPQPGlrPQERVLETGRRLANYCKRFNLPFEFH 468
                          ****************************************************************9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + +a+r++++++e+L+++++E +aVn+ +q ++llde+v l+++rd+vLkl+k+ +P+++v+   + +++ + F+ rf eal++ysalf+
  Glyma.15G037200.1.p 469 A-IAQRWDTIRVEDLKIETDEFVAVNCLFQFEHLLDETVVLNNPRDAVLKLIKKANPDIFVHGIVNGSYDVPFFVSRFREALYHYSALFN 557
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                          +l+++++re+  r ++E+el+grei+n++aceg er+er +t+++W+ r ++ GF+p+pl++++ ++ k  lr  + ++ + +e + +++
  Glyma.15G037200.1.p 558 MLDTNVGREDPIRLMYEKELFGREIMNIIACEGCERVERPQTYKQWQLRNMRNGFRPLPLDQRIIDKLKGRLRDDAyNNNFLLEVDGNWV 647
                          ************************************************************************99888999********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ S+W
  Glyma.15G037200.1.p 648 LQGWKGRILYASSCW 662
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.52263642IPR005202Transcription factor GRAS
PfamPF035141.4E-107291662IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MDRRAVSSIN TDQECPLDDT DSSSALFSYI KQMLMEDDTQ ESYSIFHDSL ALQHTERSFY  60
QVITHNYPPS SSSPHHQSPE QSLSVSSSDS SSSCSTNSTS SSADSPFRSL PPLLPHSTFP  120
IPHNFFFHSN STQSSISTTL GFFDNPLAEI SDSAFLQQFE RGVDQGTRFL PLHTTPFNIN  180
VDPNNTAFSS SFTKTKTPPP QMLIKTEAEG EPFLAGRKQR QREEYEADGR SRKQSAPYMD  240
DSELSELFDK VLLGTGLGKG VPPDTTHETI LTNMFGGDAS KSDEEVVDLG TLLMLCAQAV  300
ASGSSPSFAK QLVMQIKQHS SPIGDETQRL AHYFGNALEA RLDGTGYQVY SVLLSSKRTS  360
AKDMVKAYRV YLSICPFEKL AVIFANNSIC NLSEDAKTIH IIDFGIRYGF KWPALISRLS  420
RRPGGPPKLR ITGIDVPQPG LRPQERVLET GRRLANYCKR FNLPFEFHAI AQRWDTIRVE  480
DLKIETDEFV AVNCLFQFEH LLDETVVLNN PRDAVLKLIK KANPDIFVHG IVNGSYDVPF  540
FVSRFREALY HYSALFNMLD TNVGREDPIR LMYEKELFGR EIMNIIACEG CERVERPQTY  600
KQWQLRNMRN GFRPLPLDQR IIDKLKGRLR DDAYNNNFLL EVDGNWVLQG WKGRILYASS  660
CWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-492936628374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003547015.20.0PREDICTED: scarecrow-like protein 14 isoform X1
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0R0G3S30.0A0A0R0G3S3_SOYBN; Uncharacterized protein
STRINGGLYMA15G04190.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14