PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G037000.1.p
Common NameGLYMA_15G037000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 607aa    MW: 68783.1 Da    PI: 6.6242
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G037000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3711.6e-1132386043374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av++ d+++a++lL+++++++sp gd +qRla+yf+++L++rla    ++ + +p + ++    ++ l+a+klf+  sP+ +
  Glyma.15G037000.1.p 238 TLLTQCAQAVANYDQRNANELLKQIRQHSSPFGDGLQRLAHYFANGLETRLAA---GTPSYMPLEVAT---AADMLKAYKLFVTSSPLQR 321
                          69**************************************************9...333344444444...789**************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          +++ ++ ++I   v++e+ vHi Df+i +G+QWp+L+++L++R +gpp+lRiTg++ p++g   +e++eetg+rLa+f+++++vpfe+n 
  Glyma.15G037000.1.p 322 LTNYLTTKTIISLVKNESSVHIMDFGICYGFQWPCLIKKLSDRHGGPPRLRITGIDLPQPGfrPAERVEETGRRLANFCKKFNVPFEYNC 411
                          ************************************************************9***************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           +a+++e+++l +L+++++E ++V++ ++l++l+de+v+++ +rd+vLkl+++++P+v+++   +  ++++ Fl+rf eal+++s+lfd 
  Glyma.15G037000.1.p 412 -LAQKWETIRLADLKIDRNELTVVSCFYRLKNLPDETVDVKCPRDAVLKLIRKINPNVFIHGVVNGAYSAPFFLTRFREALYHFSSLFDV 500
                          .6**************************************************************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          +ea++pre+ +r+++E+ l+gr++ nvvacegaer+er et+++W+ r  +aGFk++pl+ + +++ak ++++ + + + v e++++++l
  Glyma.15G037000.1.p 501 YEANVPREDPQRVMLEKGLFGRDAINVVACEGAERVERPETYKQWQVRNLRAGFKQLPLDPQLVNDAKDIVKREYHKDFVVAENDKWVLL 590
                          ***************************************************************************888************ PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          gWk+r L ++SaW+
  Glyma.15G037000.1.p 591 GWKGRILNAISAWT 604
                          *************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.966210584IPR005202Transcription factor GRAS
PfamPF035145.4E-111238604IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MEFTKYSNPI LRYISDILMD EEDDLECKPC MLQECLRLQA AEKSFHDALL HQNPSPFRDE  60
NTCITDSDEI FGRIPSFVSS GSCTTDNSCE SDLLNGVSEF NSSFLQLQTP LVDSPEDGYF  120
HDGTWNLFQS HTKPLMVEEG TPASALREKR SHGMDGHASH EKEGRRGSKV SAIFSDDSEP  180
REILDEVLLY QTGGSQPLYS APTEPSQRVD LGRSNGKATR LRSKKVSTNM ETTVDLWTLL  240
TQCAQAVANY DQRNANELLK QIRQHSSPFG DGLQRLAHYF ANGLETRLAA GTPSYMPLEV  300
ATAADMLKAY KLFVTSSPLQ RLTNYLTTKT IISLVKNESS VHIMDFGICY GFQWPCLIKK  360
LSDRHGGPPR LRITGIDLPQ PGFRPAERVE ETGRRLANFC KKFNVPFEYN CLAQKWETIR  420
LADLKIDRNE LTVVSCFYRL KNLPDETVDV KCPRDAVLKL IRKINPNVFI HGVVNGAYSA  480
PFFLTRFREA LYHFSSLFDV YEANVPREDP QRVMLEKGLF GRDAINVVAC EGAERVERPE  540
TYKQWQVRNL RAGFKQLPLD PQLVNDAKDI VKREYHKDFV VAENDKWVLL GWKGRILNAI  600
SAWTLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-422406038374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.215790.0cotyledon| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497665.10.0PREDICTED: scarecrow-like protein 11
TrEMBLK7M9D70.0K7M9D7_SOYBN; Uncharacterized protein
STRINGGLYMA15G04166.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-167GRAS family protein