PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G211900.1.p
Common NameGLYMA_14G211900, LOC100812229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 465aa    MW: 51416.8 Da    PI: 7.7187
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G211900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32273326255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Glyma.14G211900.1.p 273 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 326
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15270326IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28271326IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23273326IPR006447Myb domain, plants
PfamPF002498.7E-7274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTTAPDLS LHISPPTISS LNSNYEPHES NFPSRTTTVS QQAHTELSLG  60
RNFTSETPIP TPHNPYYQSQ NHFHHLHHHH HNNNNTSTSV NTTSVVTSTT STTPLNHINY  120
GVSLLDVSSS DTLRPIKGIP VYHNRSFPFV ATMDHARDNL NNNNNNNKDH YHHHKMCLYN  180
HHNMPSYPSL SSSTATPSPS PYFVDPMSLL NNGSTMAACR AATATRFNGF SGDAFKSHHP  240
LHQYGVGPSE ASSGFMRSRF LQKLPNKRSM RAPRMRWTST LHARFVHAVE LLGGHERATP  300
KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSGHS DGSGEDDLSP MVSTADRGGL  360
RQFPNHRGRP EWAAQQDMDY SSTTTTLWSN SSSCGESRLR PSSNDIDGLR SPILHSQTIS  420
GGHQIQECDS IQLKSNMPGS NLECKIPSLE FTLGRPDWDG KEQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16274328458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.47260.0root| seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.14G211900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544358.10.0transcription repressor KAN1
RefseqXP_028199153.10.0transcription repressor KAN1-like
TrEMBLA0A445HA690.0A0A445HA69_GLYSO; Transcription repressor KAN1
TrEMBLK7M8D20.0K7M8D2_SOYBN; Uncharacterized protein
STRINGGLYMA14G39260.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-50G2-like family protein