PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G190400.1.p
Common NameGLYMA_14G190400, LOC100783016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 412aa    MW: 44922.2 Da    PI: 5.0832
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G190400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.81.4e-05544639
             zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         C+ +++++   +C+++  +lC +C  + H+       H++
  Glyma.14G190400.1.p  5 CDFCGDQRSLVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                         *****************************65677777765 PP

2zf-B_box231.7e-074690442
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                          +C++++++++   C d +  lC++C   +H g       H+++++
  Glyma.14G190400.1.p 46 LVCERCNSQPAFVRCVDEKISLCQNCDWLGH-GtspssstHKRQSI 90
                         68*****************************.55888899988765 PP

3CCT64.63e-22354397144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R +a++RYkeK+ktRkFeKk+rY+sRKa+A+ R+RvKGrFvk+ 
  Glyma.14G190400.1.p 354 RSNAVMRYKEKKKTRKFEKKVRYASRKARADVRKRVKGRFVKAG 397
                          899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.428147IPR000315B-box-type zinc finger
CDDcd000212.43E-7447No hitNo description
SMARTSM003366.8E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7454390IPR000315B-box-type zinc finger
CDDcd000211.15E-44790No hitNo description
SMARTSM003360.824890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.467354396IPR010402CCT domain
PfamPF062038.5E-17354396IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGYLCDFCGD QRSLVYCRSD AACLCLSCDR NVHSANALSR RHSRTLVCER CNSQPAFVRC  60
VDEKISLCQN CDWLGHGTSP SSSTHKRQSI NCYSGCPSAA EFSSIWSFFL DIPSMGEACE  120
QELGLMSINE NSNKNAWASP EGQNVSGSAE VTDLPSKGKS WAGTSSVPES SSEPRILDQP  180
PGPANECMPK LYCPGKKVSG IYEDDDLYDD FIMDEVDLQL ENYEELFGMA LSHSEELFEN  240
GGINSLFETK DMSASAGDSH CQGAVAAEGS SAELVNAIQP ACSNAASADS MMSTKTEPIV  300
CFTARQSLSN ISFSGVTKDS VGDYQDCGAS SMLLMGEPPW CPPCPESSLH SANRSNAVMR  360
YKEKKKTRKF EKKVRYASRK ARADVRKRVK GRFVKAGDVY DYDPLNQTRS C*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.327160.0cotyledon| epicotyl| pod
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.14G190400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0688990.0HM068899.1 Glycine max CONSTANS-like zinc finger protein (COL18) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544867.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_006596415.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014622611.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014622612.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014622613.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_028200652.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200653.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200654.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200655.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200656.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200657.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200658.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028200659.10.0zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9LUA91e-146COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLA0A445H8310.0A0A445H831_GLYSO; Zinc finger protein CONSTANS-LIKE 10 isoform A
TrEMBLI1MB790.0I1MB79_SOYBN; Uncharacterized protein
STRINGGLYMA14G36930.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-121B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]