PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G139500.1.p
Common NameGLYMA_14G139500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 203aa    MW: 23488 Da    PI: 6.2562
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G139500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.21.1e-25127180155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+W  eLH++F+ av+ L G++kA Pk+il+lm+v+gLt+e+v+SHLQkY+l
  Glyma.14G139500.1.p 127 KPRLVWDVELHRKFLVAVDDL-GIDKAFPKRILDLMNVEGLTRENVASHLQKYKL 180
                          79*******************.*******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011013.548171IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.9E-127120No hitNo description
SuperFamilySSF521721.57E-11772IPR011006CheY-like superfamily
PfamPF000722.7E-5765IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.45E-9771No hitNo description
PROSITE profilePS5129410.797124183IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-26125184IPR009057Homeodomain-like
SuperFamilySSF466892.15E-17125184IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-23127180IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MLRKNINKFD LLISDVNIPD MDGFKLLELV GLQMDLPFIT KIKHFVIQGA CEYLTKPIRI  60
EELQNIWKHF ANEEKASYMA GECSQAMAPK NNTDQNIKLG QKRKEQSEDE EEEEYHKENE  120
EHLNQNKPRL VWDVELHRKF LVAVDDLGID KAFPKRILDL MNVEGLTREN VASHLQKYKL  180
DLRKPTRQPS MVAKLGSSDP CL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22125184362ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.14G139500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028188502.12e-98two-component response regulator ARR12-like
SwissprotB8AEH11e-60ORR23_ORYSI; Two-component response regulator ORR23
SwissprotQ6K8X61e-60ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A445H5G01e-148A0A445H5G0_GLYSO; Two-component response regulator ORR23
TrEMBLK7M6N91e-148K7M6N9_SOYBN; Uncharacterized protein
STRINGGLYMA14G19985.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-54response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]