PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G119100.1.p
Common NameGLYMA_14G119100, Glyma14g27290.1, LOC100796434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 592aa    MW: 66145.5 Da    PI: 4.7618
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G119100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.57e-1362215912374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+++s+g+ e+a++++++l++++s +gdp qR+aay++e+Laar+a s++ +y+al+++e +   s ++laa+++++ev+P++
  Glyma.14G119100.1.p 221 KQLLYDCARVLSEGNEEEATSMINKLRQMVSIQGDPSQRIAAYMVEGLAARVATSGKCIYQALRCKEPP---SNDRLAAMQILFEVCPCF 307
                          589*****************************************************************9...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          kf++++aN aI e v  e++vHiiDfdisqG+Q+++L+q+Las p+ pp++R+T+v++pes+  s   ++ +g+rL+k+Aeel++pfef+
  Glyma.14G119100.1.p 308 KFGYIAANGAIAEVVRDEKKVHIIDFDISQGTQYITLIQTLASMPGRPPRVRLTAVDDPESVqrSIGGINIIGQRLEKLAEELRLPFEFR 397
                          ************************************************************99888899********************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + va+r++ +++++L+++pgEal+Vn+++qlh++ de+vs+ +erd++L++vksl+Pk+v+vveq++++n+++Fl rf+e+ +yysa+fd
  Glyma.14G119100.1.p 398 A-VASRTSIVSPSMLNCRPGEALVVNFAFQLHHMRDETVSTVNERDQLLRMVKSLNPKIVTVVEQDMNTNTSPFLPRFIETYNYYSAVFD 486
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          +l+a+lpres++r++vEr++l+++ivn+vaceg+er+er e ++kWr+rl++aGF+p p+s+++ + ++ l+ k + d ++++ee g l 
  Glyma.14G119100.1.p 487 TLDATLPRESQDRMNVERQCLAKDIVNIVACEGEERIERYEVAGKWRARLSMAGFTPSPMSTNVREAIRNLIIKQYCDKFKIKEEMGGLH 576
                          ****************************************************************************899*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gW+d++L+++SaW+
  Glyma.14G119100.1.p 577 FGWEDKNLIVASAWK 591
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.057194571IPR005202Transcription factor GRAS
PfamPF035142.4E-133221591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MSLVISAELA DTSYGNAKLY TLKGTDVTPD LSSHNFAPDK HRNMYMTKSH SCESYAKYFR  60
DSPTEELIEP SSSSISGNSV HPDGASSYLL RASSGASVIV NNPFDTSIWS TRHRDAYQSN  120
SGSDFVENGS PDGLDFDGEM RLKLQELERA LLSDEEEEEE GMFETVQSME IDPDMVEWAN  180
PLQDMLLHDS PKESSSSDSS NLTSISSTTK DTSQNSPQTP KQLLYDCARV LSEGNEEEAT  240
SMINKLRQMV SIQGDPSQRI AAYMVEGLAA RVATSGKCIY QALRCKEPPS NDRLAAMQIL  300
FEVCPCFKFG YIAANGAIAE VVRDEKKVHI IDFDISQGTQ YITLIQTLAS MPGRPPRVRL  360
TAVDDPESVQ RSIGGINIIG QRLEKLAEEL RLPFEFRAVA SRTSIVSPSM LNCRPGEALV  420
VNFAFQLHHM RDETVSTVNE RDQLLRMVKS LNPKIVTVVE QDMNTNTSPF LPRFIETYNY  480
YSAVFDTLDA TLPRESQDRM NVERQCLAKD IVNIVACEGE ERIERYEVAG KWRARLSMAG  540
FTPSPMSTNV REAIRNLIIK QYCDKFKIKE EMGGLHFGWE DKNLIVASAW K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-532225916375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.202770.0epicotyl| root| seed coat| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311600.0KT031160.1 Glycine max clone HN_CCL_175 GRAS transcription factor (Glyma14g27290.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544730.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_014622473.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_014622474.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0B2SW590.0A0A0B2SW59_GLYSO; Scarecrow-like protein 1
TrEMBLI1MAD80.0I1MAD8_SOYBN; GRAS transcription factor
STRINGGLYMA14G27290.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP82621116
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]