PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G091000.1.p
Common NameGLYMA_14G091000, LOC100807072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34410.4 Da    PI: 6.6656
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G091000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.4e-20142196256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ ++tkeq  +Lee F+++++++ ++++eLA+kl+L  rqV vWFqNrRa+ k
  Glyma.14G091000.1.p 142 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTK 196
                          78889************************************************98 PP

2HD-ZIP_I/II120.21.1e-38142230190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rl+keq+++LEe+F+e+++L+p++K+ela +L+l++rqv+vWFqnrRARtk+kq+E+d+e Lk+++d+l+een++L+ke +eL+ +
  Glyma.14G091000.1.p 142 RKKLRLTKEQAAVLEENFREHSTLNPKQKQELAMKLNLRARQVEVWFQNRRARTKLKQTESDCELLKKCCDTLTEENKKLQKELQELK-S 230
                          69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.491138198IPR001356Homeobox domain
SuperFamilySSF466892.87E-18139206IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-17140203IPR009057Homeodomain-like
SMARTSM003891.7E-15140202IPR001356Homeobox domain
CDDcd000861.70E-14141199No hitNo description
PfamPF000462.6E-17142196IPR001356Homeobox domain
PROSITE patternPS000270173196IPR017970Homeobox, conserved site
PfamPF021834.7E-9198230IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.3E-17198241IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSFHDTSNTG LGLGLGLGLV SFHDQSENCM KSTNDPLREI HKIKKVENPS KCNSTYPSLT  60
LGPPDDDDDD DDEVNNQPPS SKTESYEYFR PHVSSPSAVS SFSNYSSIKR ERDQVLWEKE  120
FEVEVEKVPT RVGDVDEDGN PRKKLRLTKE QAAVLEENFR EHSTLNPKQK QELAMKLNLR  180
ARQVEVWFQN RRARTKLKQT ESDCELLKKC CDTLTEENKK LQKELQELKS IQATPMPLYM  240
QIPAATLCIC PSCERICGGN NNSDGGNNNN GSSHTTSLLI GSKTHHHSFY KSNKYPFPHS  300
SSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190198RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.14G091000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0994120.0BT099412.1 Soybean clone JCVI-FLGm-13F4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003544508.10.0homeobox-leucine zipper protein HAT9
RefseqXP_028199823.10.0homeobox-leucine zipper protein HAT9-like
SwissprotA2XE767e-61HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL47e-61HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A445H3W10.0A0A445H3W1_GLYSO; Homeobox-leucine zipper protein HOX19
TrEMBLI1M8Y00.0I1M8Y0_SOYBN; Uncharacterized protein
STRINGGLYMA14G10370.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-45homeobox from Arabidopsis thaliana