PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G021100.1.p
Common NameGLYMA_14G021100, LOC100790640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 144aa    MW: 16201.3 Da    PI: 8.274
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G021100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.44.9e-3841041101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk +rr+C++dC+++pyfpa++p++fa vh+++G snv k+l+++p   re+a++sl++eA++r++dPvyG++g+i+kl +q++++
  Glyma.14G021100.1.p   4 RCAACKNQRRRCPSDCIFSPYFPANDPERFARVHRIYGGSNVGKMLQQIPSYLREQAANSLYFEAQCRIQDPVYGCAGIISKLYEQINST 93 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          +  la++++++
  Glyma.14G021100.1.p  94 EIALAHVQTQI 104
                          ****9999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.6123104IPR004883Lateral organ boundaries, LOB
PfamPF031957.2E-384101IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSGRCAACKN QRRRCPSDCI FSPYFPANDP ERFARVHRIY GGSNVGKMLQ QIPSYLREQA  60
ANSLYFEAQC RIQDPVYGCA GIISKLYEQI NSTEIALAHV QTQIACQKLQ VPQAKAESNF  120
NVFPAQNSST AEFQWESQVP WFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-32510912119LOB family transfactor Ramosa2.1
5ly0_B4e-32510912119LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.14G021100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150366e-52AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595718.11e-104LOB domain-containing protein 24
RefseqXP_028201029.11e-104LOB domain-containing protein 24-like
SwissprotP594686e-44LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A445H0F81e-102A0A445H0F8_GLYSO; LOB domain-containing protein 24
TrEMBLK7M4H21e-102K7M4H2_SOYBN; Uncharacterized protein
STRINGGLYMA14G02440.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-46LOB domain-containing protein 24