PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G337600.1.p
Common NameGLYMA_13G337600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 658aa    MW: 73661.7 Da    PI: 5.3638
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G337600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.25.3e-1132896553374
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av+s d+++a+ lL+++++++s  gd +qRla+yf+++L+ rla  ++      + ++ + ++s++ l+a+kl++  sP+ +
  Glyma.13G337600.1.p 289 TLLTQCAQAVASFDQRNANDLLSQIRQHSSAFGDGLQRLAHYFANGLQIRLAA-GTP-----SYTPLEGTTSADMLKAYKLYVTSSPLQR 372
                          69**************************************************9.333.....33333334489***************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          +++ +a ++I+  v +e  vHiiDf+i +G+QWp+L+++L++R +gpp+lRiTg++ p++g   +e++eetg+rLa+++++++vpfe+n 
  Glyma.13G337600.1.p 373 LTNYLATKTIVSLVGNEGSVHIIDFGICYGFQWPCLIKKLSERHGGPPRLRITGIELPQPGfrPAERVEETGRRLANYCKKFKVPFEYNC 462
                          ************************************************************9***************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           +a+++e+++l +L+++++E+++V++ ++l++l+de+v+++s+rd+vLkl+++++P+++++   +  +n++ Fl+rf eal+++s+lfd+
  Glyma.13G337600.1.p 463 -LAQKWETIKLADLKIDRNEVTVVSCFYRLKNLPDETVDVKSPRDAVLKLIRRINPNMFIHGVVNGTYNAPFFLTRFREALYHFSSLFDM 551
                          .6**************************************************************************************** PP

                 GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                          +ea++pre+ er+++E+ l+gr++ nv+acegaer+er et+++W+ r ++aGFk+v+++   +++ k +++k +++ + v e+ +++ l
  Glyma.13G337600.1.p 552 FEANVPREDPERVMLENGLFGRDAINVIACEGAERVERPETYKQWQVRNQRAGFKQVRFDPLLVNDEKEMVKKEYQKDFVVAEDGKWVWL 641
                          ***************************************************************************999************ PP

                 GRAS 361 gWkdrpLvsvSaWr 374
                          gWk+r L ++SaW+
  Glyma.13G337600.1.p 642 GWKGRILNAISAWT 655
                          *************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.821261635IPR005202Transcription factor GRAS
PfamPF035141.8E-110289655IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MSSNFLVEFN MNSLVQNFGG PISVFSNQDQ VEKGFDFEFD DSSSPSSGTS SGGESTEVTK  60
YSNPILRYIS DILMDEEDDL ERKPCMLQEC LRLQAAEKSF HDALLHQNPS SCFSDENYGR  120
TVSFESCTTD NSCESELVNG VGEFDSSFLQ LQTPLVHDPF GESQAAGYFH DGTWNLFQSQ  180
SQTKPLMVEE GSSASAPREK RSHGMDDYAS HEQEGRRGSK VSAVFSDESE SPEILDEVLL  240
CQSGRSQALL CAATEPSQSV DLGGSNGKAT RSRSKKVSAK AGTAVDLWTL LTQCAQAVAS  300
FDQRNANDLL SQIRQHSSAF GDGLQRLAHY FANGLQIRLA AGTPSYTPLE GTTSADMLKA  360
YKLYVTSSPL QRLTNYLATK TIVSLVGNEG SVHIIDFGIC YGFQWPCLIK KLSERHGGPP  420
RLRITGIELP QPGFRPAERV EETGRRLANY CKKFKVPFEY NCLAQKWETI KLADLKIDRN  480
EVTVVSCFYR LKNLPDETVD VKSPRDAVLK LIRRINPNMF IHGVVNGTYN APFFLTRFRE  540
ALYHFSSLFD MFEANVPRED PERVMLENGL FGRDAINVIA CEGAERVERP ETYKQWQVRN  600
QRAGFKQVRF DPLLVNDEKE MVKKEYQKDF VVAEDGKWVW LGWKGRILNA ISAWTPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-432916548374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.215790.0cotyledon| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497665.10.0PREDICTED: scarecrow-like protein 11
TrEMBLK7M3F90.0K7M3F9_SOYBN; Uncharacterized protein
STRINGGLYMA13G41261.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-166GRAS family protein