PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G335200.1.p
Common NameGLYMA_13G335200, LOC100787775
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 270aa    MW: 29538.7 Da    PI: 10.5008
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G335200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-3870128462
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  Glyma.13G335200.1.p  70 GVLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKNK 128
                          5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2855121IPR003851Zinc finger, Dof-type
PfamPF027017.3E-3371126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53472126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWQQQQQ NQHQANGSNS PHELLPPLPQ PPQAPHVGVE SEQIRSGLMA  60
DRAKIPAPEG VLKCPRCEST NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG ALRNVPVGGG  120
CRRNKKNKRS RSKSPVSTEK PSLPNNTSAI PELIGRFPQP FMASLQSMNR YGVGINTGVN  180
LREIQAQNAS QMEFQIGGLG NGSSVATAGG GGGGGVEQWR FQQFPVNSAA SNSTLFKVKL  240
LKVWLEILMP QVLGLLSCQH GLKWNITVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.21000.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:10758484}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G335200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595464.10.0dof zinc finger protein DOF3.6
SwissprotQ9M2U15e-50DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLK7M3D90.0K7M3D9_SOYBN; Uncharacterized protein
STRINGGLYMA13G41031.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.18e-40DNA binding with one finger 2.4