PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G329000.1.p
Common NameGLYMA_13G329000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 286aa    MW: 31592.3 Da    PI: 8.62
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G329000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.83.2e-402483261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++s
  Glyma.13G329000.1.p 24 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKKRSS 83
                         6899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282281IPR003851Zinc finger, Dof-type
PfamPF027018.2E-342682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1892882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MNPSSGQPQQ MSSQSVEKKP KPHPEQALKC PRCDSTNTKF CYYNNYSLSQ PRYFCKSCRR  60
YWTKGGTLRN VPVGGGCRKK RSSSLKRAQD QTLTPNLNPL TTLPHLSYDS NDFTLAVARF  120
QKQSSGQLGY NDRDLSTLGN PTTGSFCDIL GNSGMNPSSA NPSFLDAIRT GFLETQNHLQ  180
NLYCMYGNGD LGEVDNGNSG VVGVSGEMML PYDQVIMSNA TTQSVSVMKQ EMCSRREQSE  240
RRVLGGFPWQ INADTNIGEL DSGRTIASWN SFTNSWHGFL QSPLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286780.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G329000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572610.0DQ857261.1 Glycine max Dof11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028188641.10.0dof zinc finger protein DOF5.3-like
TrEMBLI1M4N90.0I1M4N9_SOYBN; Uncharacterized protein
STRINGGLYMA13G40420.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-38TARGET OF MONOPTEROS 6