PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G304900.1.p
Common NameGLYMA_13G304900, LOC100802093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 468aa    MW: 52211.8 Da    PI: 6.387
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G304900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.61.8e-88554492373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsP 89 
                          ++lLl+cA a++s+d +laq++++ l++ asp gd++qRl++ f++AL +r +r +++ ++   +++     + + +++++l  ++++ P
  Glyma.13G304900.1.p  55 EKLLLHCASALESNDITLAQQVMWVLNNVASPVGDTNQRLTSWFLRALISRASRICPTAMSFKGSNTI----QRRLMSVTELagYVDLIP 140
                          689***************************************************77766643322222....333334444466****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                          +++f++ + N+ I++a+ g +rvHi+Df+i++++QWp++++ La+RpegppslRiT+ +   ++    + +++e+g rL +fA+  +vpf
  Glyma.13G304900.1.p 141 WHRFGYCASNNEIYKAITGFQRVHIVDFSITHCMQWPTFIDGLAKRPEGPPSLRITVPSCRPHVpplVNISIHEVGLRLGNFAKFRDVPF 230
                          ********************************************************9888555588999********************* PP

                 GRAS 177 efnvl....................vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvv 242
                          efnv+                     +  l+ l++ +L+++++Eal++n++  l +l d++  ++      rd++L+l+k+l+P++v +v
  Glyma.13G304900.1.p 231 EFNVIgntegpltpaelsdestsfhFEAMLSLLNPTMLNLREDEALVINCQNWLRYLSDDRKGISCqsfsLRDAFLNLIKGLNPRIVLLV 320
                          *****************9999998556689999*************************9987665444669******************* PP

                 GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                          ++++d++++s+  r++ ++++ +  fd+le+ lp++s +r+  E   +g++i+n++  eg +r+er e+  + ++r++++G+ +vp+ ++
  Glyma.13G304900.1.p 321 DEDCDLSASSLTSRITTCFNHLWIPFDALETFLPKDSCQRSEFESD-IGQKIENIIGYEGHQRIERLESGVQMSQRMKNVGYLSVPFCDE 409
                          **********************************************.******************************************* PP

                 GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          ++ ++k ll +++  g+ ++ e+g lvl+Wk+++ v+++aW
  Glyma.13G304900.1.p 410 TVREVKGLLDEHA-SGWGMKREEGMLVLTWKGNSCVFATAW 449
                          *************.8899*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.33428431IPR005202Transcription factor GRAS
PfamPF035146.0E-8655449IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MQVTSSQSHM KAELKGTTSI SFQNPNTALF NTPHNNPLSG ALKGCLGSLD GACIEKLLLH  60
CASALESNDI TLAQQVMWVL NNVASPVGDT NQRLTSWFLR ALISRASRIC PTAMSFKGSN  120
TIQRRLMSVT ELAGYVDLIP WHRFGYCASN NEIYKAITGF QRVHIVDFSI THCMQWPTFI  180
DGLAKRPEGP PSLRITVPSC RPHVPPLVNI SIHEVGLRLG NFAKFRDVPF EFNVIGNTEG  240
PLTPAELSDE STSFHFEAML SLLNPTMLNL REDEALVINC QNWLRYLSDD RKGISCQSFS  300
LRDAFLNLIK GLNPRIVLLV DEDCDLSASS LTSRITTCFN HLWIPFDALE TFLPKDSCQR  360
SEFESDIGQK IENIIGYEGH QRIERLESGV QMSQRMKNVG YLSVPFCDET VREVKGLLDE  420
HASGWGMKRE EGMLVLTWKG NSCVFATAWV PCEILRDHHI GMDASLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-26524492374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543373.20.0PREDICTED: scarecrow-like protein 32
TrEMBLA0A0B2RWE50.0A0A0B2RWE5_GLYSO; Scarecrow-like protein 32
TrEMBLK7M2U40.0K7M2U4_SOYBN; Uncharacterized protein
STRINGGLYMA13G38080.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-121GRAS family protein