PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G241900.1.p
Common NameGLYMA_13G241900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 279aa    MW: 30980.4 Da    PI: 7.7255
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G241900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.86.3e-3542101261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          +++ lkcprCds ntkfCyynny+ sqPr++C+aC+r+WtkGG+lrnvPvGggr++++ +
  Glyma.13G241900.1.p  42 PSEPLKCPRCDSINTKFCYYNNYNKSQPRHYCRACKRHWTKGGTLRNVPVGGGRKNKRVK 101
                          67899***********************************************97766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-194390IPR003851Zinc finger, Dof-type
PfamPF027013.8E-314598IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.9946100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGLSSKQVSN RGLDWNQTLL EAQNLELPKP PPMRKQQQQT QPSEPLKCPR CDSINTKFCY  60
YNNYNKSQPR HYCRACKRHW TKGGTLRNVP VGGGRKNKRV KKSTTPNTAT ATNSISTTTT  120
TSNTNMDVDD HKTTPSSLYQ SLCLPQQNLM MSTKDSEEGK DFGIGNGIFL SSTVPFPQSQ  180
SLLFPFTTSN SFDTNQCAIS SSLRSSSVYN YGEEFKITEE PTINSIMPNA SGGTNTQPWE  240
IAATSSGLEM SNYWTWEDID SLVSTDLNVP WDDSDIKP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.250180.0flower| hypocotyl
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G241900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217510.0EF221751.1 Glycine max Dof6 transcription factor (Dof6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236850.20.0Dof26
RefseqXP_028186897.10.0dof zinc finger protein DOF1.4-like
TrEMBLI1M2830.0I1M283_SOYBN; Uncharacterized protein
STRINGGLYMA13G31560.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-24DOF zinc finger protein 1