PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G213400.1.p
Common NameGLYMA_13G213400, LOC100776034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 777aa    MW: 86783.3 Da    PI: 6.8477
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G213400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.52.9e-36113189177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv++Ce+d+se+k yhrrh+vC  +++a++v+++g+ +r+CqqC++fh ls+fDe+krsCrr+L++hn rrr+k 
  Glyma.13G213400.1.p 113 RCQVPACEVDISELKGYHRRHRVCLRCANAATVMLNGEAKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNTRRRRKP 189
                          6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-27108175IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.333111188IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-33112190IPR004333Transcription factor, SBP-box
PfamPF031107.2E-27114188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MEPLSLPPLP VMDDAEDPSS IWDFSYLLDF DLDDQDIIIN NNNSLPLPLN DHPAPSEIPQ  60
NDRVRKRDPR LTCSNFLAGR VPCACPELDA ILEDEGLPGK KRARTARASA SARCQVPACE  120
VDISELKGYH RRHRVCLRCA NAATVMLNGE AKRYCQQCGK FHVLSDFDEG KRSCRRKLER  180
HNTRRRRKPT ADSGGATHSE LLQPVAENEE NNYDVEAGKD CSNLSTDIND VGVSLDLEDE  240
PAPIPSSAPE AQNINSDSVV SLAVSGETRV NSGNTSNSPS YCDNKSAYSS MCQTGRISFK  300
LYDWNPAEFP RRLRHQIFQW LASMPVELEG YIRPGCTILT IFIAMPNIMW INLLKDPLEY  360
VHDIVAPGKM LSGRGTALVH LNDMIFRVMK DGTSVTNVKV NMHAPKLHYV HPTYFEAGKP  420
MEFVACGSNL LQPKFRLLVS FSGKYLKCEY CVPSPHSWTE DNISCAFDNQ LYKIYVPHTE  480
ESLFGPAFIE VENESGLSNF IPVLIGDKKI CTEMKTLQQK LDVSLLSKQF RSASGGSICS  540
SCETFALSHT SSSDLLVDIA WLLKDTTSEN FDRVMTASQI QRYCHLLDFL ICNDSTIILG  600
KILPNLIILT ESMKSNVVIN RTSDVDIMQL LNHIHNARNA VYQKHPKSES IIVHSEMKGF  660
ILAQGCSQDN KLSVAINSQG IQSRADEKWG VLKVKSPTSN EKMERIPLLK RDIIMSMEEL  720
PERYGRRCLG RGFLTFRPAI FVLVSVAVCL GVCVAVLHPG RVSELAVSVR RCLFNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-43112195486squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174186RRKLERHNTRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.192210.0cotyledon| flower| leaf| meristem| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G213400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541650.10.0squamosa promoter-binding-like protein 7
TrEMBLK7M1060.0K7M106_SOYBN; Uncharacterized protein
STRINGGLYMA13G28460.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7