PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G177600.1.p
Common NameGLYMA_13G177600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 329aa    MW: 35933.6 Da    PI: 10.3226
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G177600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.11.6e-374199260
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                         +++++kcprCds+ntkfCy+nnyslsqPr+fCkaC+ryWt GG++rn+PvGgg+rk k+
  Glyma.13G177600.1.p 41 PQQHQKCPRCDSMNTKFCYFNNYSLSQPRHFCKACKRYWTLGGTFRNIPVGGGSRKVKR 99
                         68899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.5E-324399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.9224599IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-184689IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MIKKTNTHYT KFRSQRDKDM EQEGEKGREE KRQIQQQQPP PQQHQKCPRC DSMNTKFCYF  60
NNYSLSQPRH FCKACKRYWT LGGTFRNIPV GGGSRKVKRG KTNSPSSSSS SSSSCSNLLS  120
QPQQNLLMRP SPPPLTTNTM VQSTSPYYYN LGVGGNGYLS FHSSLNNNTP SQPSDQYLKV  180
GGGDHVAGSS NISPLVSGFN NAASYSLPPR FHHQQQQQSM HPAQQQQQRL INIPSNMASS  240
SSDVSHSGVR PQSLINNVST STDHNVSTST NHRAITTSDA SLWSAATINA TSIGGNSDQN  300
NVVKGSSSSS SSLVPNLWVH RPGFGPPQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.286760.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G177600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572590.0DQ857259.1 Glycine max Dof9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028189391.10.0dof zinc finger protein DOF1.4-like
TrEMBLA0A0R0GQ420.0A0A0R0GQ42_SOYBN; Uncharacterized protein
STRINGGLYMA13G24611.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3613022
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.14e-24Dof family protein