PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G155400.1.p
Common NameGLYMA_13G155400, LOC100795697
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family ARR-B
Protein Properties Length: 681aa    MW: 75246.4 Da    PI: 6.2911
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G155400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94.1e-27209262155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprl+W  eLH++F+ av++L G++kA Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Glyma.13G155400.1.p 209 KPRLVWDAELHRKFLAAVNHL-GIDKAFPKRILDLMNVEGLTRENVASHLQKYRL 262
                          79*******************.********************************8 PP

2Response_reg78.81.9e-26131211109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+++ + +l+++l+k +y +v+++ ++ +ale+l++++  +Dl++ D++mp+mdG++ll+     e++lp+i+++++g++e + +
  Glyma.13G155400.1.p  13 VLAVDDDKTCLTVLENLLRKCQY-NVTTTNQAIKALEMLRKNRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSGYGDKERVMR 100
                          799********************.***************998889*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l+Kp+ +eel +
  Glyma.13G155400.1.p 101 GVIQGACDYLTKPVRIEELQN 121
                          ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.9E-1472679IPR017053Response regulator B-type, plant
SuperFamilySSF521723.84E-3610133IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.7E-4210134No hitNo description
SMARTSM004485.0E-3211123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.57612127IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-2313121IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.37E-2814127No hitNo description
Gene3DG3DSA:1.10.10.601.5E-27206266IPR009057Homeodomain-like
PROSITE profilePS5129411.389206265IPR017930Myb domain
SuperFamilySSF466891.79E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24209262IPR006447Myb domain, plants
PfamPF002497.5E-6212261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MVVGDRFPVG MRVLAVDDDK TCLTVLENLL RKCQYNVTTT NQAIKALEML RKNRNKFDLV  60
ISDVNMPDMD GFKLLELVGL EMDLPVIMLS GYGDKERVMR GVIQGACDYL TKPVRIEELQ  120
NIWQHVLRRR IDSKDKNKTA SEGKGCSMAG KFANEEKARY MAGECSQAMA PKNNTDQNIK  180
LGQKRKELSE DEEEEEYDKE NEEHSNQKKP RLVWDAELHR KFLAAVNHLG IDKAFPKRIL  240
DLMNVEGLTR ENVASHLQKY RLGLRKPTQQ PSMVAALGSS DPYLQMDSVE GFRTLSGSVG  300
MLSTTLPSYA SGGVFCRLNP PSGLRGVNSA LFQPVLSQNN SMSAKAFGNM QLSMFSANQT  360
SSLLQGIPTS IDANKFQQNR SPGIRKLSPL DDSSGFKVSS GFSDTRATVI NPNNFVHDLS  420
NNHLLLQRNS PPAQNSGAFR NHSSLGAASV NTQSFDPGIC ELDHNRHNKS WQGTTQISKF  480
PTNTSAVSKV FTHDQLAQNN LKFSSSTFCS GNSPVDFSST RAIAPPLEDA RGKLQSQEGL  540
LENILLASCY TQHQSWESDK RGCNKDMSQT FNSTKSVSPN GDTSSLGHSL DQNNSVSSEG  600
IGASLVNPSI TQSNEGEKFY SMKSNDACIL RSMESQEGLM QNTFGSLNDI MSEITEQEQN  660
TIMLMDGELE FDLDHAFDSF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-24207266362ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G155400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541468.10.0two-component response regulator ARR12
SwissprotB8B3I41e-109ORR22_ORYSI; Two-component response regulator ORR22
TrEMBLI1LZL80.0I1LZL8_SOYBN; Two-component response regulator
STRINGGLYMA13G22320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-106response regulator 12