PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G124900.1.p
Common NameGLYMA_13G124900, LOC100775656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 527aa    MW: 59132 Da    PI: 6.4439
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G124900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.25.3e-1061645211374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                          l++lL+ecA a+s ++l +a+++L +l ++asp++ +  +R++ayf++A+ +r+++s+ ++++ l   ++         +a+++f+++sP
  Glyma.13G124900.1.p 164 LITLLMECAVAISVDNLGEAHRMLLELTQMASPYKaSCAERVVAYFAKAMTSRVMNSWLGVCSPLVDHKS-------INSAFQVFNNISP 246
                          5789*****************************997889*******************999976654444.......567999******* PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          ++kf+h+t NqaIleav++++ +HiiD+di+qGlQWpa+++ La+R eg+p++ +Tg+g+    s e l etg++L++fA++lg++++f+
  Glyma.13G124900.1.p 247 FIKFAHFTSNQAILEAVSHCDSIHIIDLDIMQGLQWPAFFHILATRMEGKPKVTMTGLGA----SMELLVETGKQLTNFARRLGLSLKFH 332
                          ************************************************************....9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          ++++k  e +++++L+vkpgEa+aV++    h+l+d +++  +    +L+l+ +l+P+++++veq+++h ++sFl+rf+ +l+yys+lfd
  Glyma.13G124900.1.p 333 PIATKFGEVIDVSMLHVKPGEAVAVHWLQ--HSLYDATGPDWK----TLRLLEELEPRIITLVEQDVNH-GGSFLDRFVASLHYYSTLFD 415
                          *877788889******************9..999999999888....**********************.789***************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF.kpvplsekaakqaklllrkvk.sdgyrveeesgs 357
                          sl a l++++++r+ vE+ ll+rei nv+a  g +r  +  ++++Wr+ l +  F k+vpls++ ++qa+l+l++++   gy++ + +g+
  Glyma.13G124900.1.p 416 SLGAYLHNDDSNRHRVEHGLLSREINNVLAIGGPKRSGED-NFRQWRSELARHCFvKQVPLSDNSMAQAQLILNMFSpAYGYSLAQVEGT 504
                          **********************************977665.5********99887478******************************** PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l lgWkd +L+++SaW+
  Glyma.13G124900.1.p 505 LRLGWKDTSLYTASAWT 521
                          ****************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.085138500IPR005202Transcription factor GRAS
PfamPF035141.8E-103164521IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MMNVGFEVIH ANYNPNMIHP HMHETWDHYS NTITSLPFSA PTPSNPYPKP ATENNHCLNL  60
GQNELCDWME EHISDITKHF VEDLPETTTS DNLLSNNPTG VVSHHNLGVP SLLSPNFTQR  120
KPSCFRPQFE SFTNDPPNFN LHIQTNTSTL DQNKHNVYDQ GLNLITLLME CAVAISVDNL  180
GEAHRMLLEL TQMASPYKAS CAERVVAYFA KAMTSRVMNS WLGVCSPLVD HKSINSAFQV  240
FNNISPFIKF AHFTSNQAIL EAVSHCDSIH IIDLDIMQGL QWPAFFHILA TRMEGKPKVT  300
MTGLGASMEL LVETGKQLTN FARRLGLSLK FHPIATKFGE VIDVSMLHVK PGEAVAVHWL  360
QHSLYDATGP DWKTLRLLEE LEPRIITLVE QDVNHGGSFL DRFVASLHYY STLFDSLGAY  420
LHNDDSNRHR VEHGLLSREI NNVLAIGGPK RSGEDNFRQW RSELARHCFV KQVPLSDNSM  480
AQAQLILNMF SPAYGYSLAQ VEGTLRLGWK DTSLYTASAW TCCNSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-501685208374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621421.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9M3841e-136SCR_ARATH; Protein SCARECROW
TrEMBLI1LYM40.0I1LYM4_SOYBN; Uncharacterized protein
STRINGGLYMA13G18680.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF117873138
Representative plantOGRP1135757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.11e-129GRAS family protein