PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G102800.1.p
Common NameGlyma13g00310.1, LOC100812222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 214aa    MW: 24499 Da    PI: 8.8262
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G102800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.27e-1992146256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Le+ F+++++++  +++ LA++l+L++rqV vWFqNrRa+ k
  Glyma.13G102800.1.p  92 RKKLRLSKEQSSMLENSFKQHSTLNPVQKQALADQLNLKTRQVEVWFQNRRARTK 146
                          677889***********************************************98 PP

2HD-ZIP_I/II113.41.5e-3692180190
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LE+sF+++++L+p +K++la +L+l++rqv+vWFqnrRARtk+kq+E+d+e Lk+++++l++en+rL+ke +eLr +
  Glyma.13G102800.1.p  92 RKKLRLSKEQSSMLENSFKQHSTLNPVQKQALADQLNLKTRQVEVWFQNRRARTKLKQTEVDHELLKKHCQNLSDENKRLKKELQELR-A 180
                          69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-1879149IPR009057Homeodomain-like
PROSITE profilePS5007117.03888148IPR001356Homeobox domain
SMARTSM003898.3E-1690152IPR001356Homeobox domain
CDDcd000861.78E-1492149No hitNo description
PfamPF000463.4E-1692146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1792146IPR009057Homeodomain-like
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
SMARTSM003403.9E-17148191IPR003106Leucine zipper, homeobox-associated
PfamPF021835.6E-7148182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MEDNNEECIT GLCLGIGMGG HVPKKNKQKE NKAVACLDLA FELCPKGEEA INVNLHHHHH  60
EKVERISLER IHEYPNEKST DSDNSNNNNR CRKKLRLSKE QSSMLENSFK QHSTLNPVQK  120
QALADQLNLK TRQVEVWFQN RRARTKLKQT EVDHELLKKH CQNLSDENKR LKKELQELRA  180
LKVGPSPLCI QLSKTATLTT MCSSCDRELK LVN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18995RCRKKLR
2140148RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.297681e-75root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G102800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311690.0KT031169.1 Glycine max clone HN_CCL_118 homeodomain/HOMEOBOX transcription factor (Glyma13g00310.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543728.11e-155homeobox-leucine zipper protein HAT3
RefseqXP_028196947.11e-155homeobox-leucine zipper protein HAT3-like
SwissprotP466024e-47HAT3_ARATH; Homeobox-leucine zipper protein HAT3
SwissprotP466655e-47HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0B2QS181e-153A0A0B2QS18_GLYSO; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0K2CT211e-153A0A0K2CT21_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1LVK01e-153I1LVK0_SOYBN; Uncharacterized protein
STRINGGLYMA13G00310.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-47homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]
  3. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  4. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]