PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G062500.1.p
Common NameGLYMA_13G062500, LOC100775675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 489aa    MW: 53320.4 Da    PI: 6.4289
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G062500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-39122181261
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG +rnvPvG+grrknk+ 
  Glyma.13G062500.1.p 122 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGVMRNVPVGAGRRKNKNF 181
                          7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30119179IPR003851Zinc finger, Dof-type
PfamPF027019.5E-32124180IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901126180IPR003851Zinc finger, Dof-type
PROSITE patternPS013610128164IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MLEAKDSTMM KLFGNTIPAP EIPAGAPAFS SGDVFGDSVG QNRGSSSVNG DGEEHEIQQD  60
IMGEETTESK KEDEVTNLDT VSRSGEGSIN PSTEKEDLTL KTSKKTEQEQ GENSQNKTLR  120
KPDKILPCPR CNSMDTKFCY YNNYNVNQPR HFCKNCQRYW TAGGVMRNVP VGAGRRKNKN  180
FASQYRHITV PEAALSSSQP DLSNGVSNPS LNCNATLLAY GSDRPLCESM TSVLNLADKA  240
VNNSTTNGFN GSEELEIPVT YVGGEKVNDD SNKSSDTSTK PMKGETTNRS QEQVIENCHP  300
FPPHVPYFPG APWPFPWNPA PWNSPVPLPP PFFPQGFTMP LYPAAAYWSL TIPGARSIPW  360
LAQPSLLNST VSNSGPNSLT LGKHSREENM HKSNGVAVED EHSKENNKEK CLWVPKTLRI  420
DDLGEAAKTS IWTTLGIKNN KADLFPGGGL FKSLPSQGGE KNRVIKNSPV LHANPAALSR  480
SINFQETS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G062500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934690.0BT093469.1 Soybean clone JCVI-FLGm-24K11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014620776.10.0cyclic dof factor 2
TrEMBLI1LWK90.0I1LWK9_SOYBN; Uncharacterized protein
STRINGGLYMA13G05480.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-86cycling DOF factor 2