PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G045500.1.p
Common NameGLYMA_13G045500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family M-type_MADS
Protein Properties Length: 301aa    MW: 34121.3 Da    PI: 4.4983
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G045500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.11.1e-13948140
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                         k i+n++ r+ tf  Rr+ ++KK +E S+LC++e+++i++
  Glyma.13G045500.1.p  9 KHISNERSRKKTFMERRKVLIKKISEFSTLCGVEACLIVY 48
                         68*************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.09E-16161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.456152IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-12160IPR002100Transcription factor, MADS-box
CDDcd002667.69E-16249No hitNo description
PRINTSPR004049.6E-8323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-141150IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRARISLKH ISNERSRKKT FMERRKVLIK KISEFSTLCG VEACLIVYDD GNGDIEPVTC  60
PKDPVLAHSI LQNYEFQKNQ RPPKKFGIQD FVEDRKNIIE AEISKVHKEI TNIKYPTSDP  120
SFINMEEDQL RAFIALVDAK IRTCDHSLKN MHQSEANFMQ NMAWGSASSS HPTPMEPLNN  180
NGRVDVTNSI DQVYEAMQLV DAPFSYIPDM VQKSFNCLQN ISQSQPILDV EDEMVGFSNR  240
VDVSLDTTNQ IADLLDWFDG PIIGWSDLVD WTSQPDESQN EQQGGGDLDG FQTECYNLNF  300
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.525740.0seed coat
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G045500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0939980.0BT093998.1 Soybean clone JCVI-FLGm-14K20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001356230.10.0agamous-like MADS-box protein
TrEMBLI1LX340.0I1LX34_SOYBN; Uncharacterized protein
STRINGGLYMA13G07720.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-19M-type_MADS family protein