PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G009300.1.p
Common NameGLYMA_13G009300, LOC100800832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 410aa    MW: 44607.9 Da    PI: 4.7621
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G009300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.5e-06444539
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         +C+ +++++   +C+++  +lC +C  + H+       H++
  Glyma.13G009300.1.p  4 ICDFCGDQRSMVYCRSDAACLCLSCDRNVHSAnalskrHSR 44
                         7*****************************65677777765 PP

2zf-B_box21.16.5e-074688440
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvv 40
                           C++++++++   C + +  lC++C   +H g       H+++
  Glyma.13G009300.1.p 46 LLCERCNSQPAFVRCVEEKISLCQNCDWLGH-GtstssstHKRQ 88
                         57*****************************.547778888765 PP

3CCT64.24e-22352395144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R +a++RYkeK+ktR F+Kk+rY+sRKa+A+ R RvKGrFvk+ 
  Glyma.13G009300.1.p 352 RSNAVMRYKEKKKTRMFDKKVRYASRKARADVRRRVKGRFVKAG 395
                          899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.542147IPR000315B-box-type zinc finger
CDDcd000214.57E-7447No hitNo description
SMARTSM003365.7E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7174390IPR000315B-box-type zinc finger
CDDcd000211.43E-44790No hitNo description
SMARTSM003361.64890IPR000315B-box-type zinc finger
PfamPF062033.3E-17352394IPR010402CCT domain
PROSITE profilePS5101715.279352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGYICDFCGD QRSMVYCRSD AACLCLSCDR NVHSANALSK RHSRTLLCER CNSQPAFVRC  60
VEEKISLCQN CDWLGHGTST SSSTHKRQAI NCYSGCPSAA ELSSIWSFVL DIAAISESTC  120
EQELGLMSIN ENKSVGVPPE GQNVSGSDEV TDQPALDKSL VGTSSMPESS SKPRILDQPA  180
RPANECLSKL YCPATKFPAL CENDNLYDDF NMDEVDLNLE NYEELFGMAL SHSEELFENG  240
GIDSLFGTKD MSAGDFSCED AIAAEGSSVG QVNVMQPACS NAASADSILS TKTEPILCFT  300
GRQAQSNLSF SGVTGDSSAG DYQDCGASSM LLMGEPPWFA PCPENSLQSA NRSNAVMRYK  360
EKKKTRMFDK KVRYASRKAR ADVRRRVKGR FVKAGDVYDY DPLSTTRSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.619070.0stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G009300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0979890.0BT097989.1 Soybean clone JCVI-FLGm-22F8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003542186.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_006593876.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014621873.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_014621874.10.0zinc finger protein CONSTANS-LIKE 9
RefseqXP_028197901.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028197902.10.0zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_028197903.10.0zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-157COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0B2PSA80.0A0A0B2PSA8_GLYSO; Zinc finger protein CONSTANS-LIKE 9
TrEMBLK7LYE40.0K7LYE4_SOYBN; Uncharacterized protein
STRINGGLYMA13G11592.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-144CONSTANS-like 9