PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G226000.1.p
Common NameGLYMA_12G226000, LOC100305703
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SBP
Protein Properties Length: 188aa    MW: 21007.4 Da    PI: 8.6657
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G226000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.3e-4066142278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cq+e C adl+ ak+yhrrhkvCe hskap+v+v+gl+qrfCqqCsrf el efDe+krsCrrrLa+hnerrrk++a
  Glyma.12G226000.1.p  66 CQAEMCGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFQELAEFDEAKRSCRRRLARHNERRRKSNA 142
                          **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-3458127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.34263140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-3664144IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3166139IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MEIKSRERIQ VSIEKVRRDS TVEVEDEEEE DESVVGGEGG LAEDEKKKGG GGSGRRGSSG  60
VSPPSCQAEM CGADLTVAKR YHRRHKVCEL HSKAPSVMVA GLRQRFCQQC SRFQELAEFD  120
EAKRSCRRRL ARHNERRRKS NAETCNEGCS GSKGQHPTES HCRNADVWGR IQMNIAKNSG  180
YNSFHIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3454139184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.386170.0flower
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G226000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0989280.0BT098928.1 Soybean clone JCVI-FLGm-16D18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540473.11e-135squamosa promoter-binding-like protein 3
RefseqXP_028194818.11e-135squamosa promoter-binding-like protein 3
SwissprotQ387411e-39SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A445HTX41e-133A0A445HTX4_GLYSO; Squamosa promoter-binding protein 1
TrEMBLI1LV251e-133I1LV25_SOYBN; Uncharacterized protein
STRINGGLYMA12G35460.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.29e-18squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]