PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G197300.1.p
Common NameGLYMA_12G197300, LOC100805056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 461aa    MW: 51464.9 Da    PI: 6.5628
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G197300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2951.9e-90514442373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsP 89 
                          ++lLl+cA a++s+d +laq++++ l++ asp gd++qRl++ f++AL +r +r +++ ++   +++     + + +++++l  ++++ P
  Glyma.12G197300.1.p  51 EKLLLHCASALESNDVTLAQQVMWVLNNVASPVGDTNQRLTSWFLRALISRASRICPTAMSFKGSNTI----QRRLMSVTELagYVDLIP 136
                          689***************************************************77766643322222....333334444466****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpf 176
                          +++f++ + N+ I++a+ g +rvHi+Df+i++++QWp++++aLa+RpegppslRiT+ +   ++    + +++e+g rL +fA+  +vpf
  Glyma.12G197300.1.p 137 WHRFGYCASNNEIYKAITGFQRVHIVDFSITHCMQWPTFIDALAKRPEGPPSLRITVPSCRPHVpplVNISIHEVGLRLGNFAKFRDVPF 226
                          ********************************************************9888555588999********************* PP

                 GRAS 177 efnvl...................vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvve 243
                          efnv+                    +  l+ l++ +L+++++Eal++n++  l +l d++  ++      rd++L+++k+l+P++v +v+
  Glyma.12G197300.1.p 227 EFNVIgntgplttaelsdestnfhFEAMLSLLNPTMLNLREDEALVINCQNWLRYLSDDRKGISRqslsLRDAFLNIIKGLNPRIVLLVD 316
                          ***************99999988555688999*************************99877766556689******************* PP

                 GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                          +++d++++s+  r++ ++++++  fd+le+ lp++s +r+  E   +g++i+n+++ eg +r+er e+  + ++r++++G+ +vp+ +++
  Glyma.12G197300.1.p 317 EDCDLSASSLTSRITTCFNHMWIPFDALETFLPKDSCQRSEFESD-IGQKIENIISYEGHQRIERSESGVQMSQRMKNVGYLSVPFCDET 405
                          *********************************************.******************************************** PP

                 GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          + ++k ll +++  g+ ++ e+g lvl+Wk+++ v+++aW
  Glyma.12G197300.1.p 406 VREIKGLLDEHA-SGWGMKREEGMLVLTWKGNSCVFATAW 444
                          ************.8899*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.46824426IPR005202Transcription factor GRAS
PfamPF035146.6E-8851444IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MHVTSSQSHM KAELKGTTSI SFQNPTTTLF NNPLSGALKG CLGSLDGACI EKLLLHCASA  60
LESNDVTLAQ QVMWVLNNVA SPVGDTNQRL TSWFLRALIS RASRICPTAM SFKGSNTIQR  120
RLMSVTELAG YVDLIPWHRF GYCASNNEIY KAITGFQRVH IVDFSITHCM QWPTFIDALA  180
KRPEGPPSLR ITVPSCRPHV PPLVNISIHE VGLRLGNFAK FRDVPFEFNV IGNTGPLTTA  240
ELSDESTNFH FEAMLSLLNP TMLNLREDEA LVINCQNWLR YLSDDRKGIS RQSLSLRDAF  300
LNIIKGLNPR IVLLVDEDCD LSASSLTSRI TTCFNHMWIP FDALETFLPK DSCQRSEFES  360
DIGQKIENII SYEGHQRIER SESGVQMSQR MKNVGYLSVP FCDETVREIK GLLDEHASGW  420
GMKREEGMLV LTWKGNSCVF ATAWVPCEMR DHIGIDAGLS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-564444681474Protein SHORT-ROOT
5b3h_B6e-574444627420Protein SHORT-ROOT
5b3h_E6e-574444627420Protein SHORT-ROOT
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G197300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539510.20.0scarecrow-like protein 32
RefseqXP_028193686.10.0scarecrow-like protein 32
TrEMBLA0A445HST30.0A0A445HST3_GLYSO; Scarecrow-like protein 32
TrEMBLI1LU930.0I1LU93_SOYBN; Uncharacterized protein
STRINGGLYMA12G32350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-121GRAS family protein