PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G063800.1.p
Common NameGLYMA_12G063800, LOC100816635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 308aa    MW: 33056.9 Da    PI: 9.6437
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G063800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3969129262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt GGalrnvPvGgg+r+nkk++
  Glyma.12G063800.1.p  69 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTSGGALRNVPVGGGCRRNKKNK 129
                          57889*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3353122IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3372127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5973127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVFSSIPVFV DPPNWQQQPN HPQASNNGGD NSQLLPPLPP HQPHVGGSVG SIRPGSMADR  60
ARLAKIPPPE AALKCPRCDS TNTKFCYFNN YSLSQPRHFC KTCRRYWTSG GALRNVPVGG  120
GCRRNKKNKR SRSKSPASSE KQTLSGSTSA TPSGGTTHEL VGQLPQPPNL PFMASLQNLN  180
RYAVGNMGLG LREIHGQNEN MGFQIGNSSA AGGGMDQWRI QQVPFLNGFE STSAGSYPFQ  240
NEGIETPSGF GGDIATNSRV SQMPSVKMEE SGALNLSRST LNVSENNQYY SWTDMSGLAS  300
SSATHLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.215440.0meristem| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.12G063800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352950.0AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539681.10.0dof zinc finger protein DOF3.6
RefseqXP_028192634.10.0dof zinc finger protein DOF3.6-like
TrEMBLA0A0B2RIH20.0A0A0B2RIH2_GLYSO; Dof zinc finger protein DOF3.6
TrEMBLK7LTC40.0K7LTC4_SOYBN; Uncharacterized protein
STRINGGLYMA12G06880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-48OBF-binding protein 3